KEGG   Xanthomonas albilineans: XALC_1825Help
Entry
XALC_1825         CDS       T01160                                 

Definition
(GenBank) putative succinate dehydrogenase membrane anchor subunit protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
xal  Xanthomonas albilineans
Pathway
xal00020  Citrate cycle (TCA cycle)
xal00190  Oxidative phosphorylation
xal00650  Butanoate metabolism
xal01100  Metabolic pathways
xal01110  Biosynthesis of secondary metabolites
xal01120  Microbial metabolism in diverse environments
xal01130  Biosynthesis of antibiotics
xal01200  Carbon metabolism
Module
xal_M00009  Citrate cycle (TCA cycle, Krebs cycle)
xal_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
xal_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:xal00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    XALC_1825
   00650 Butanoate metabolism
    XALC_1825
  Energy metabolism
   00190 Oxidative phosphorylation
    XALC_1825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: CBA16315
UniProt: D2U8L2
Position
complement(2147445..2147831)
Genome map
AA seq 128 aa AA seqDB search
MSRYRTPLKNVRGLGAAKSGTEHFVLQRLTATALVGLTIWFLTLVLSLLGADYVTATQAV
AKPWNAVLLVGFLIAMFWHAQIGLQVILEDYVHNSLLALALQTTVKFIAVLGAIVGVFAV
ARIALGSA
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgctaccgtaccccgctgaagaacgtccgcggcttgggcgcggccaagtccggc
accgaacacttcgtgctgcaacggctcaccgccaccgccctggtcggcttgaccatttgg
ttcctgacgttggtgctgagcttgctcggtgccgactatgtcaccgcgacccaggcggtc
gccaaaccgtggaatgccgtgctgctggtcggctttttgatcgcgatgttctggcatgcg
cagatcggactgcaggtaattctcgaagactacgtgcacaactcgctgctggccctggcg
ctgcagaccacggtgaagttcatcgccgtgctcggcgcgatcgtcggtgtattcgcggtc
gcccgcattgcgctgggcagcgcctga

DBGET integrated database retrieval system