KEGG   Xanthomonas albilineans: XALc_1915Help
Entry
XALc_1915         CDS       T01160                                 

Definition
pectinesterase precursor signal peptide protein (EC:3.1.1.11)
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
xal  Xanthomonas albilineans
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:xal00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:xal00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2237988..2239256
Genome map
AA seq 422 aa AA seqDB search
MRLPTWLYAYALLALFQPLACNAQKLIGTADRPQLSNADAKNYTASTYLARAGKIGSMVT
DNWNPSAGVALLSPSYHVAADGSAPFASVQAAVDKAVADGGTMRRYIGIEPGVYREVVCI
PETAPPITLFGMGQTPSNTLITFNNANLTPKPVGTPTTPCASNADAAVIGTFGSATFTVS
ADAFQARNLTFANDYVEGTYPGTNQSAVALAVRGDKAVFEKIAVLGNQDTLLVGPVDTTL
VKRTYFKDSVVQGDTDFIFGAGIAVFYHSIIRYDARRLNGSGKAYLFAPSTHPGNPYGFL
VIDSIFDVVGDAVGNTIYLGRAWDQSTPNLPNYVNGKSPNGQLTIRNSILGAHIRKDAPW
SNSTAKRPYCSESCTYSANRFYEYSNSGPGSADFHHPHGYRSNRGGGRSNQQADTYAAHL
SS
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgcgacttccaacttggctgtacgcctatgcattactggcgctttttcagcccctcgct
tgcaatgcacaaaagttgataggcactgccgacagaccacaattaagcaacgccgatgcg
aagaactatacggcctccacctaccttgcccgagccggcaagatcggttcgatggtcacc
gacaattggaacccaagcgcgggcgtggcactgctgagccccagctatcacgtcgctgcc
gacggctccgcaccattcgccagtgttcaggcagcggtggacaaggcagtggcggacgga
ggcacaatgcgccgctacatcggcatcgaaccaggggtctacagagaagtggtatgcatc
cctgaaacggcgccgccgatcacgctgttcggcatgggccaaacccccagcaacacgcta
atcaccttcaacaatgccaatctgacgccaaaaccagtcggtacccccaccactccatgc
gctagcaatgccgatgcggccgtcattggtactttcggtagcgccacattcacagtaagc
gctgacgcattccaggcgcgcaatctgaccttcgccaacgattatgtggaggggacctac
ccaggcaccaaccaatcggcggtcgccctggccgtacgcggcgacaaggcggttttcgaa
aaaatcgcggtactgggcaatcaggacactctgctggtcggccccgtcgacacaacattg
gtgaaacgcacatacttcaaggacagcgtggtacaaggcgacaccgacttcatcttcggc
gcaggtatcgcagtcttttaccacagcattatccgctatgatgccagacgtttgaacggc
agcggcaaagcctatctattcgctccaagcacccatcccggcaacccatacggttttctt
gtcatcgacagcatcttcgacgtcgtcggtgatgccgtcggcaacactatttatcttggc
cgcgcctgggaccagagcacccccaatcttcccaactatgtcaatggcaaatcacccaat
ggacaattgacaatccgcaattcgatactcggcgcacatatacgcaaagacgcgccatgg
agcaactctactgccaaacgcccttattgcagtgaaagctgcacctattccgcaaaccgt
ttctacgaatattccaacagcggcccaggcagtgccgatttccatcacccccacgggtat
cgatcgaatcgcggtggcggccgttccaatcagcaagccgatacatatgctgcccatctt
tcttcctga

DBGET integrated database retrieval system