KEGG   Xanthomonas albilineans: XALc_1934Help
Entry
XALc_1934         CDS       T01160                                 

Definition
cellulase precursor
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
xal  Xanthomonas albilineans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:xal00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2261333..2263066)
Genome map
AA seq 577 aa AA seqDB search
MKRSHPLWSLSLVCLLVGGCASRADEDALPSPIRLNQVGFLPAASKLAVVPDGHGTAFAV
ERADSGEVVLRGTLGAAALWPPAQETVRIADFSALRAPGHYRLRVDGLTPSDDFAIAENA
YDALSRAALKAYYYNRASTALSGKYAGRHARAAGHPDDHVLIHASAASPARPAGTVIAAP
KGWYDAGDYNKYVVNSGITVYTLLAAYEQFPGYFATHKEGIPGSGGGVPDILREVDWNLQ
WLLAMQDPHDGGVYHKLTNLEFSGMQMPDQANAPRYVVQKSTAATLDFAAVMAQASRIYA
PFDAQFGGVSARMLKAAHRAWAWAQAHPDAIYRQPPDVHTGAYADDHLDDEFAWAATELY
LATADNAYYDAAMARHVPINVPYWGNVGGLAWMSLAQHRARLTRHADQARIAREIEGLAD
HLTQVWQHSAWRVAMTSQDFQWGSNSAVLGQAMLLLQAYQVQPKPEYLQAAQSQLDYVLG
RNPLGMSFVTGIGARSPMHIHHRISIADGLATPVPGLLVGGPQPGQQDAEVCKHAYTSTL
PALSYLDKECSYATNEVAINWNAPLVYVSTALQVLQR
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgatcccatcctctgtggtccctgtctctggtgtgcctgctcgttggcggttgc
gcgtcgcgcgccgatgaggatgccttaccatcgccgatccggctcaaccaggtcggtttc
ttgccggctgccagtaagctggcggtagtaccggatggtcacggcaccgcgttcgcggtg
gagcgggccgactcgggcgaggtggtgttgcgcggtaccctcggcgcggcggcgctctgg
ccaccggcgcaagagacggtgcggatcgccgatttttccgccttgcgcgccccaggccac
taccggctgcgggtggatggcttaaccccatcggacgatttcgccatcgccgagaacgcc
tacgacgcgctgtcgcgtgccgcgctcaaagcctattactacaaccgcgccagcactgcg
ttgtccggcaagtacgccggccgtcacgcgcgcgccgccggccatcccgacgaccacgtg
ctgatccacgcctcggcagcgtcgcccgcgcgtccggctggtaccgtgatcgccgcgccc
aagggctggtacgacgctggcgactacaacaagtacgtggtcaattccggtatcaccgtc
tacacattgctggccgcctacgagcagttcccagggtatttcgctacgcacaaggaaggg
attcccggcagcggcggcggtgtgccggatatcctgcgcgaggtcgactggaacctgcag
tggctgttggcgatgcaggacccgcacgatggcggtgtgtaccacaaactgaccaacctg
gagttctccggcatgcagatgccggatcaggcgaatgcgccgcgctatgtggtacagaaa
agcaccgcggccacgctcgatttcgccgcggtgatggcgcaggccagtcgcatttatgcg
ccgttcgatgcgcagttcggtggagtgtccgcgcgcatgctcaaggccgcgcatcgcgcc
tgggcctgggcgcaggcgcatccggatgcgatctatcggcaaccgcccgatgtgcacacc
ggcgcctacgcggacgaccacctcgacgacgagtttgcctgggccgccacggagttgtat
ctggccaccgccgacaacgcgtattacgacgcggcgatggcgcgccatgtgccgatcaac
gtgccgtattggggcaatgtcggcggtttggcctggatgtcgttggcgcagcatcgcgcg
cggttgacccggcatgccgaccaggcgcgcatcgcccgtgagatcgagggtctggccgac
catctgacacaggtctggcaacactcggcctggcgggtcgcgatgacctcgcaggatttc
cagtggggcagcaacagcgccgtgctggggcaggcgatgctgttactgcaggcctatcag
gtgcagcccaagccagagtatctgcaggccgcacagtcgcaattggactacgtgctcggg
cgtaacccacttggcatgtcgttcgtcaccggcatcggcgcgcgttcgccgatgcacatt
catcaccgtatctccattgcagacggcctcgccacgccggtgcccggtttgttggtcggc
ggtccgcagccgggtcagcaggatgcagaggtgtgcaagcatgcttacacctcgacgctg
ccggcgctgtcctacctggacaaggagtgtagctacgcgaccaacgaagtggcgatcaac
tggaacgccccgctggtctacgtcagcacggcgttgcaggtgttgcaacgctga

DBGET integrated database retrieval system