KEGG   Xanthomonas albilineans: XALc_1947Help
Entry
XALc_1947         CDS       T01160                                 

Definition
glycoside hydrolase family 27 (EC:3.2.1.-)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
xal  Xanthomonas albilineans
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:xal00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    XALc_1947
  Lipid metabolism
   00561 Glycerolipid metabolism
    XALc_1947
   00600 Sphingolipid metabolism
    XALc_1947
Enzymes [BR:xal01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     XALc_1947
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2278773..2280368)
Genome map
AA seq 531 aa AA seqDB search
MAASRVRAVPSASRWLWRCLFALAALGGAGCAHAPPSAAAMVAASPLQGVWVIAQGAAFP
GLRYLRIAQRDGHAQGSITTDWYGDLPMQLLRLDGTVARFAIDNGNTRLPAQPWTATLEH
GQLHLVGRIWYQQIDLRATRGSEADAARLAFQFAPLPAYTPLPSDGLARTPPLGWNSWNR
FGEHIDDATVRRIADAMVASGLRDAGYVYVNIDDGWQGQRDRDGVLQPNARFPDMRALAD
YVHAKGLKLGLYSSPGPKSCAGYTGSYGHVEQDARTWAGWGIDYLKYDLCSGEGIFREPQ
QVRRAYLQMGQALRASGRPIVYSLCEYGRDHVGQWGREVGGHLWRTTGDIEDTYAKMAAN
GFDHNGDPADAGPGGWNDPDMLEVGNGGMSEDEYRTHLALWAMSAAPLLLGNDLRQMTPV
TVALLRNRAVLAIDQDALGVQGRAVRKDGAIEIWRKPLADGGVALGVFNRDAQPHLVVLT
AQDAGTALQGRRWRDLWQGQTRPARQLRSVQVAAHGVVLLRLSPPQVARRH
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggccgcctcgcgcgtgcgcgccgtgccctccgccagtcgctggctgtggcggtgcctg
ttcgctctggccgcacttggcggtgcgggttgcgcgcatgcgccgccttcagccgccgcg
atggtggcggccagtccgttgcagggagtgtgggtgattgctcagggggcagcgtttccg
ggtctgcgttatctgcgcatcgcccagcgcgacggtcatgcgcagggcagcatcaccacc
gactggtacggcgatctgccgatgcagctgttgcgcctggacggcacagtggcccggttc
gcgatcgacaacggcaatacgcgcttgccggcgcagccatggaccgcaacactggaacac
ggccaactgcatctggtcggccgcatctggtaccaacagatcgacctgcgtgctacccgc
ggcagcgaggccgacgcagcgcggctggcgttccaattcgcaccgctgccggcttacacg
ccgttgccgagcgatggcctggcgcgaaccccgccactgggctggaacagttggaaccgc
ttcggtgagcatatcgacgacgctacggtgcgccgcatcgccgatgccatggtcgcgtcc
ggcttgcgcgatgccggttacgtctacgtcaacatcgacgacggttggcagggccagcgc
gaccgtgacggcgtattgcagccgaacgcacgtttccccgacatgcgtgcgttggccgac
tacgtgcatgccaaggggctcaagctcggcctgtacagttcgccggggccgaagagttgc
gctggctataccggcagctacggccacgtcgaacaggacgcgcgcacctgggcgggctgg
ggcatcgactatctcaaatacgacctgtgctcgggcgaaggcatcttccgcgaaccgcag
caggtgcgccgcgcctacttgcagatgggccaggcgttgcgcgccagtgggcgacccatc
gtttatagcctgtgcgagtacgggcgcgatcatgtcggccaatggggccgcgaggtcggc
gggcatttgtggcgcaccaccggcgacatcgaggacacctacgcgaaaatggccgccaac
ggcttcgaccacaacggcgatccggccgatgccggccctggtggctggaacgatccggat
atgctcgaggtcggcaacggcggcatgagcgaggacgaataccgcacgcatctggcgctg
tgggccatgtcggcggcgccgttgctgttgggtaacgacctgcggcagatgaccccggtc
acggtggcgttattgcgcaaccgggcggtgttggcgatcgatcaggatgcgttgggcgtg
cagggcagggcggtgcgcaaggacggcgcgatcgaaatttggcgcaagccgttggccgat
ggcggcgttgcgttgggcgtgttcaaccgcgacgcgcagccgcacctggtggtgctgacc
gcgcaggacgccggaaccgcattgcagggccggcgctggcgcgatctatggcagggccag
acgcgcccggcgcgccaactgcgcagcgtgcaggtcgctgcgcatggcgtggtattgctg
cggctgtcgccgccgcaggttgcacgcaggcattga

DBGET integrated database retrieval system