KEGG   Xanthomonas albilineans: XALc_1947Help
Entry
XALc_1947         CDS       T01160                                 

Definition
glycoside hydrolase family 27 (EC:3.2.1.-)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
xal  Xanthomonas albilineans
Pathway
Galactose metabolism
Glycerolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:xal00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:xal00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2278773..2280368)
Genome map
AA seq 531 aa AA seqDB search
MAASRVRAVPSASRWLWRCLFALAALGGAGCAHAPPSAAAMVAASPLQGVWVIAQGAAFP
GLRYLRIAQRDGHAQGSITTDWYGDLPMQLLRLDGTVARFAIDNGNTRLPAQPWTATLEH
GQLHLVGRIWYQQIDLRATRGSEADAARLAFQFAPLPAYTPLPSDGLARTPPLGWNSWNR
FGEHIDDATVRRIADAMVASGLRDAGYVYVNIDDGWQGQRDRDGVLQPNARFPDMRALAD
YVHAKGLKLGLYSSPGPKSCAGYTGSYGHVEQDARTWAGWGIDYLKYDLCSGEGIFREPQ
QVRRAYLQMGQALRASGRPIVYSLCEYGRDHVGQWGREVGGHLWRTTGDIEDTYAKMAAN
GFDHNGDPADAGPGGWNDPDMLEVGNGGMSEDEYRTHLALWAMSAAPLLLGNDLRQMTPV
TVALLRNRAVLAIDQDALGVQGRAVRKDGAIEIWRKPLADGGVALGVFNRDAQPHLVVLT
AQDAGTALQGRRWRDLWQGQTRPARQLRSVQVAAHGVVLLRLSPPQVARRH
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggccgcctcgcgcgtgcgcgccgtgccctccgccagtcgctggctgtggcggtgcctg
ttcgctctggccgcacttggcggtgcgggttgcgcgcatgcgccgccttcagccgccgcg
atggtggcggccagtccgttgcagggagtgtgggtgattgctcagggggcagcgtttccg
ggtctgcgttatctgcgcatcgcccagcgcgacggtcatgcgcagggcagcatcaccacc
gactggtacggcgatctgccgatgcagctgttgcgcctggacggcacagtggcccggttc
gcgatcgacaacggcaatacgcgcttgccggcgcagccatggaccgcaacactggaacac
ggccaactgcatctggtcggccgcatctggtaccaacagatcgacctgcgtgctacccgc
ggcagcgaggccgacgcagcgcggctggcgttccaattcgcaccgctgccggcttacacg
ccgttgccgagcgatggcctggcgcgaaccccgccactgggctggaacagttggaaccgc
ttcggtgagcatatcgacgacgctacggtgcgccgcatcgccgatgccatggtcgcgtcc
ggcttgcgcgatgccggttacgtctacgtcaacatcgacgacggttggcagggccagcgc
gaccgtgacggcgtattgcagccgaacgcacgtttccccgacatgcgtgcgttggccgac
tacgtgcatgccaaggggctcaagctcggcctgtacagttcgccggggccgaagagttgc
gctggctataccggcagctacggccacgtcgaacaggacgcgcgcacctgggcgggctgg
ggcatcgactatctcaaatacgacctgtgctcgggcgaaggcatcttccgcgaaccgcag
caggtgcgccgcgcctacttgcagatgggccaggcgttgcgcgccagtgggcgacccatc
gtttatagcctgtgcgagtacgggcgcgatcatgtcggccaatggggccgcgaggtcggc
gggcatttgtggcgcaccaccggcgacatcgaggacacctacgcgaaaatggccgccaac
ggcttcgaccacaacggcgatccggccgatgccggccctggtggctggaacgatccggat
atgctcgaggtcggcaacggcggcatgagcgaggacgaataccgcacgcatctggcgctg
tgggccatgtcggcggcgccgttgctgttgggtaacgacctgcggcagatgaccccggtc
acggtggcgttattgcgcaaccgggcggtgttggcgatcgatcaggatgcgttgggcgtg
cagggcagggcggtgcgcaaggacggcgcgatcgaaatttggcgcaagccgttggccgat
ggcggcgttgcgttgggcgtgttcaaccgcgacgcgcagccgcacctggtggtgctgacc
gcgcaggacgccggaaccgcattgcagggccggcgctggcgcgatctatggcagggccag
acgcgcccggcgcgccaactgcgcagcgtgcaggtcgctgcgcatggcgtggtattgctg
cggctgtcgccgccgcaggttgcacgcaggcattga

DBGET integrated database retrieval system