KEGG   Xanthomonas albilineans: XALc_2015Help
Entry
XALc_2015         CDS       T01160                                 

Gene name
asnB
Definition
asparagine synthase b protein
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
xal  Xanthomonas albilineans
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:xal00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2372277..2373968)
Genome map
AA seq 563 aa AA seqDB search
MCSIFGIFGLQPGDDLQALRRQALDCSQRQRHRGPDWSGVYVDAGAILVHERLAIVDPAG
GAQPLLSDDGQLALAVNGEIYNHRELKQQLTQPYAFQTGSDCEVINALYREQAPVALLDR
LNGIFAFALWDKAAGRVLIARDPMGVCPLYWGHDAQGRLRLASEMKSLADSCADVAQFPP
GHYYDSASGTLVQYYRRPWRDYAAVQGVEVSKQALREAFERAVHRQLMTDVPYGVLLSGG
LDSSLVAAVAARFARKRIEENDQAEAWWPRLHSFAIGLKGSPDLAAAAIAAEALGTVHHG
FEYTFEEGLDALPEVIRHIETYDVTTIRASTPMFLLARRIKAMGVKMVLSGEGSDEIFGG
YLYFHKAPNAREFHEELIRKLDALYNYDCLRANKSMMAWGVEPRVPFLDVEFLEVAMRMD
AQHKMAGTRADGSKRIEKAVLREAFEGYLPESILWRQKEQFSDGVGYGWIDGLKAHADTQ
VSDRELAAADKRFSVNPPQTKEAYYYRSLFERAFPTPAAAETVPGGKSIACSSPAAIAWD
ASFASMADPSGRAVAGVHEQALT
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgtgttcgattttcggcatcttcggcctgcaaccgggcgacgatttgcaggcattgcgt
cggcaggcgctggattgctcgcaacggcagcgccatcgcggtcctgattggagcggtgtg
tatgtcgacgcgggtgcgatcctggtgcatgagcgcctggccatcgttgatccggctggt
ggcgcgcagcccttgctgtccgatgacggccagttagccctggcggttaacggtgagatc
tacaaccatcgcgaactgaaacagcaactgacgcagccctatgcgttccagaccggttcg
gattgcgaggtgatcaacgcgctgtaccgcgagcaggcaccagtcgcgttgctcgaccgg
ctcaatggtatcttcgctttcgcgttgtgggacaaggccgcaggccgcgtgctgattgcg
cgcgatccgatgggcgtgtgcccgctgtactggggccatgacgcgcaggggcgcttgcgc
ttggcctcggagatgaaatcgctggccgacagttgcgccgacgtcgcccaattcccgcca
ggccactactacgacagtgccagtggcacgttggtgcagtactaccgcaggccgtggcgc
gattacgccgccgtgcagggcgtggaggtgagcaagcaggcactgcgcgaggcgttcgag
cgcgccgtgcatcgccaattgatgaccgacgtgccctatggcgtgttgctgtccggcggc
ctggattcctcgctggtggcggcggtggccgcgcgctttgcgcgcaagcggatcgaggag
aacgaccaggccgaggcctggtggccgcgcctgcattccttcgcgattggcctaaaggga
tcgcccgatttggccgctgccgcgattgccgccgaggcgctgggcaccgtgcatcacggc
ttcgaatacaccttcgaggaaggtcttgatgcgctgccggaggtcattcggcatatcgag
acctacgacgtcaccaccatccgcgcttccactccgatgttcctgttggcgcggcggatc
aaggcgatgggagtgaagatggtgctgtccggcgagggcagtgacgaaattttcggtggc
tatttgtattttcacaaggcaccgaacgcgcgcgagttccatgaagagctgatccgcaaa
ctcgacgcgttgtacaactacgattgcctgcgcgccaacaagtcgatgatggcctggggc
gtggagccgcgcgtgccgtttctggatgtggaatttctggaggtggcgatgcgcatggac
gcccagcacaaaatggcgggcacccgcgccgatggcagcaagcgcatcgagaaggcggtg
ttgcgcgaggcgttcgagggctatctgccggagtcgatcctgtggcggcagaaggagcag
ttcagcgatggcgtcgggtatggctggatcgatgggttgaaggcgcatgccgacacgcag
gtcagcgaccgcgaactcgccgcggccgataagcgcttctcggtgaatccgccgcaaacc
aaggaagcctattactaccgtagtctgttcgaacgcgctttccccacgccagcggcagcc
gagaccgtgcccggcggcaagtcgattgcgtgctcctcgccagcggcgattgcctgggac
gcgagtttcgcttcgatggccgatccctccgggcgggcggtggccggcgtgcacgaacag
gcgctgacctga

DBGET integrated database retrieval system