KEGG   Xanthomonas albilineans: XALC_2067Help
Entry
XALC_2067         CDS       T01160                                 

Gene name
gpmA
Definition
(GenBank) probable phosphoglycerate mutase protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
xal  Xanthomonas albilineans
Pathway
xal00010  Glycolysis / Gluconeogenesis
xal00260  Glycine, serine and threonine metabolism
xal00680  Methane metabolism
xal01100  Metabolic pathways
xal01110  Biosynthesis of secondary metabolites
xal01120  Microbial metabolism in diverse environments
xal01130  Biosynthesis of antibiotics
xal01200  Carbon metabolism
xal01230  Biosynthesis of amino acids
Module
xal_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:xal00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XALC_2067 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    XALC_2067 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XALC_2067 (gpmA)
Enzymes [BR:xal01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     XALC_2067 (gpmA)
Membrane trafficking [BR:xal04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    XALC_2067 (gpmA)
Exosome [BR:xal04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   XALC_2067 (gpmA)
  Exosomal proteins of melanoma cells
   XALC_2067 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: CBA16551
UniProt: D2UEH7
Position
complement(2434056..2434805)
Genome map
AA seq 249 aa AA seqDB search
MTRKLVLLRHGQSQWNLDNRFTGWVDVDLTEQGRQEAVAAGRLMREERLQFDVAHTSMLK
RAIHTLQGALNALDQDWLPVHKSWRLNERHYGGLQGLDKAETAAKHGEEQVKIWRRSYDI
PPPPMDAADPGHPLHDRRYATLDRNALPATESLASTLDRVLPYWHDAIAPQLKAGQTVLV
TAHGNSLRALYKYLNAVSREQILELNIPTGIPLLFELDDALQVRSYRYLGDPEAAKRAAE
AVANQGKAK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
gtgacccgtaaactcgtactgttgcgccatggccagagccagtggaacctggataaccgt
ttcaccggctgggtggacgtggacctcaccgagcaaggccgtcaggaagccgtggccgcc
ggtcggctgatgcgcgaggagcggctgcaattcgatgtggcgcatacctcgatgctcaag
cgcgccattcacaccttgcagggggcgctgaacgcgctggatcaggattggttgcctgta
cacaagagctggcgcctcaacgagcggcactatggcggcttgcaaggcctggacaaggcc
gaaaccgccgccaaacacggcgaggaacaggtcaagatctggcgccgttcctacgatatc
ccgccgccgccgatggatgccgccgatccgggccacccgctgcacgaccgccgttatgcc
acactcgaccgcaatgcgctgccggctaccgagtcgctggcgagcacgctcgatcgcgtg
ctgccgtactggcacgatgccatcgcgccgcaactcaaggctggacagacggtgctggtc
actgcacacggcaattcgctgcgcgcgctgtacaagtatttgaacgcggtctcgcgcgag
cagattctcgaactcaacatccccaccggcatcccgctgttgttcgaactggacgacgcc
ttgcaagtgcgctcctaccgctatctaggcgacccggaagcggcgaagcgtgccgccgag
gcagtggccaatcagggcaaggcgaagtaa

DBGET integrated database retrieval system