KEGG   Xanthomonas albilineans: XALC_2115Help
Entry
XALC_2115         CDS       T01160                                 

Definition
(GenBank) putative methylamine utilization protein
  KO
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
xal  Xanthomonas albilineans
Brite
Enzymes [BR:xal01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     XALC_2115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2500753..2501823
Genome map
AA seq 356 aa AA seqDB search
MRRIVWLSLLAGTALSIGAAAYALTSLQQREKHQAALATSALGSALFHDTSLSATGTLAC
ATCHRADYAFTQPEAVPHLDGGRVGTRNAPSLLDLPYFQHYFWDGREDHIERVAVAAFTN
RAEMAQPNMAAVVDLLRRQPAYRQRFQASFGDDNIDEARISRAILAYLHSVANGHSRYDA
YAAGDTSALTESERRGLAIFQGKADCAACHRLDGTPATFTDNRFHHSNVGLEQLAGHVKT
TIAAFQAKRQQGVPLAELVLSDPEMAALGRFAVDGHGDNLSAYRTPTLRNVTRTAPYMHD
GSVPSLDAAIQREIYYRSLTRGTPITLTTQEQGDLHAFLYALEDAPLRNAQAPGAE
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaggatcgtctggctcagtctgcttgcaggcaccgcactctccatcggggctgcg
gcctatgcactgacatccctgcagcagcgggaaaaacatcaggctgctctggccacctcc
gcgctgggcagtgcgctgttccatgacacctcgttgagtgcgaccggcaccttggcatgc
gccacctgccatcgcgcggattacgctttcacccagcccgaggcggtcccgcatctggac
ggcggccgtgtcggcacgcgcaatgcgcccagtttgctggacttgccatattttcagcat
tatttctgggatgggcgagaagaccacattgagcgcgtcgccgtcgccgccttcaccaac
cgggcggaaatggcgcaaccaaacatggcggcagtggtcgacctgctgcgcaggcaaccg
gcctatcggcaacgcttccaggcatccttcggcgatgacaacatcgatgaggcgcggatt
tcgcgcgcgatcctggcctatctccattctgtcgccaacgggcatagccgttacgatgcc
tatgccgccggcgacaccagcgcgctgacagaatcagaacgtcgcggcctggcgatcttc
caagggaaagccgactgcgccgcgtgccatcggctcgacggcacgccggcaaccttcacc
gataatcgcttccatcactccaatgtcggcttggaacagttggccggccacgtgaaaacc
accatcgcggcctttcaagccaaacggcagcagggagttccgcttgccgaattggtgctc
tcggatccggagatggcagcgctggggcgtttcgccgtggacggccatggcgacaaccta
tcggcataccgcaccccaacgctgcgcaatgtcacccgcaccgcgccttatatgcacgac
ggcagtgtgccgtcgctggatgcggcaatacaacgggaaatctattaccgcagcctgacg
cgcggcaccccgatcacgctaacgacgcaggagcagggcgacctgcatgccttcctgtat
gcgcttgaagacgctccgctgcgaaatgctcaagcacccggcgcggagtga

DBGET integrated database retrieval system