KEGG   Xanthomonas albilineans: XALC_2133Help
Entry
XALC_2133         CDS       T01160                                 

Gene name
murA
Definition
(GenBank) probable udp-n-acetylglucosamine 1-carboxyvinyltransferase protein (EC:2.5.1.7)
  KO
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
xal  Xanthomonas albilineans
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xal00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    XALC_2133 (murA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    XALC_2133 (murA)
Enzymes [BR:xal01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     XALC_2133 (murA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2514852..2516126)
Genome map
AA seq 424 aa AA seqDB search
MAKIVVTGGNALHGEVNISGAKNAVLPILCATLLADAPVEITNVPQLHDVITTVKLLGEL
GAEVTIDEGTLARGSAITVDPRKVDQHIAPYELVRTMRASILVLGPLLAKFGEAEVSLPG
GCAIGSRPVDQHIKGLQALGAEISVENGYIKASSNGRLKGGRYVFDMVSVTGTENVLMAA
TLAEGITVLENAAMEPEVGDLADCLIALGARIEGAGTSRIVVQGVERLSGGRHAVLPDRI
ETGTFLVAAAMTGGSVTVRRARADTLDAVLDKLTEAGASIETGVDFIRLDMQGKRPRAVN
LTTAPYPAFPTDMQAQFMALNCVADGVGVINETIFENRFMHVNELLRLGADIQIEGHTAI
VRGSERLSGAPVMATDLRASASLILAGLVADGDTTIDRIYHLDRGYENIEEKLGALGASI
RRVA
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggccaaaatcgtagtgaccggcggcaatgcgctgcacggtgaagtgaacatctccggc
gccaagaacgccgtgctgccgatcctgtgcgcgaccctgctggccgatgcgccagtggag
atcaccaacgtgccgcaactgcacgacgtgatcaccacggtgaagttgctcggcgaactg
ggtgcggaagtcaccatcgatgaaggcacgctggcgcgcggcagcgcgatcaccgtggat
ccgcgcaaggtcgaccagcacatcgcgccctatgaactggtacggaccatgcgcgcctcg
attctggtgctgggtccgttgctggccaagttcggcgaggcggaagtctccctgcccggc
ggctgtgcgatcggttcgcggccggtggatcaacatatcaaggggttgcaggcgctgggc
gcggaaatcagcgtcgagaacggttacatcaaggccagcagcaatggtcggctcaaggga
gggcgctatgtgttcgacatggtcagcgtcaccggcaccgagaacgtgctgatggcggcg
accctggccgagggcatcacggtgctggagaacgcggcgatggagccggaggtcggcgat
ctggccgactgcctcatcgcgcttggcgcaaggatcgagggggctggtacctcgcggatc
gtggtgcagggcgtggagcgcttgtccggcggtcgtcacgcggtgctgcccgatcgcatc
gaaaccggcaccttcctggtcgccgcggcgatgaccggtggcagcgtcaccgtgcgccgt
gcgcgtgccgacacgctcgatgcggtgctcgacaagctcaccgaggccggcgccagcatc
gagaccggcgtagacttcatccgcctggacatgcaaggcaagcgtccgcgtgcggtcaac
ctcaccactgccccgtatccagccttcccgacagacatgcaagcgcagttcatggcgctc
aactgcgtggcagacggtgtcggcgtgatcaatgagacgatcttcgagaaccgtttcatg
cacgtcaacgaactgctgcgcctgggcgcggatattcagatcgaagggcataccgcgatc
gtgcgcggcagcgaacgtctcagtggcgcgccggtgatggctaccgatctgcgtgcatcg
gcctcgctgattctggctggcctggtcgccgacggcgacaccaccatcgatcggatctac
cacctggatcgtgggtacgaaaacatcgaggaaaagctgggggcgctgggcgcgtctatc
cggcgggtcgcgtga

DBGET integrated database retrieval system