KEGG   Xanthomonas albilineans: XALc_2155Help
Entry
XALc_2155         CDS       T01160                                 

Gene name
PyrB
Definition
aspartate carbamoyltransferase, catalytic subunit protein
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
xal  Xanthomonas albilineans
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xal00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    XALc_2155 (PyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    XALc_2155 (PyrB)
Enzymes [BR:xal01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     XALc_2155 (PyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2543054..2544001)
Genome map
AA seq 315 aa AA seqDB search
MTHPQLDFHGRLRHLLTLEGLPRATLLQLLDRAGQIRDAAVGRVGKRSVLAGSAVCTLFF
EPSTRTRSSFQLAAQRLGADVLNFDASTSSTRKGETARDTLKNLEAMGVRGFIVRHPEDG
AVARLAEAAGEGTALINAGDGLSAHPTQGLLDMLTLRHAKGGDFSKLKLIIVGDVKHSRV
ARSDLHALRTLGAGEVRVCGPRALLPDDDTLDGCVVGDDLDAMIEGVDAVMMLRLQRERM
EEGLVASLEQYHTQYGLNAERLRRAAKDAVVLHPGPINRGVEITDEVADGAQSCVLRQVA
NGVAVRMAVLETLLG
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgacccatccgcaactcgattttcatggacgcctgcgtcacttgctcacgttggaagga
ctgccgcgtgcgaccctgttgcaactgctggaccgcgccggtcagatccgcgacgcagcg
gtgggacgggtcggcaagcgcagcgtgctggccgggagcgcagtgtgtacgctgttcttc
gagccgtccacgcgcacccgtagttcgtttcaactggccgcgcagcggctgggcgcggac
gtgctgaacttcgatgcctccacctcgtcaacgcgcaagggcgagaccgcgcgcgacacg
ttgaaaaatctggaagccatgggcgtgcgcggcttcatcgtgcgccatccggaggacggc
gcagtcgcgcggcttgccgaagcggcgggcgaggggactgcgctgatcaacgccggcgat
ggcctcagtgcgcatccgacccagggcctgctcgacatgctgaccctgcgccatgccaag
ggcggcgatttctccaagctcaagttgatcatcgtcggcgacgtcaaacactcgcgagtg
gcgcgctctgacttgcatgccctacgcactctgggtgccggcgaggtgcgcgtgtgcggc
ccgcgtgcgctgctgccggacgacgacaccctggatggctgcgtggtcggcgatgacctc
gacgccatgatcgagggcgtggacgcggtgatgatgctgcgtctacagcgcgaacgcatg
gaggaaggcctggtggcctcgctggagcagtatcacactcagtacggcctcaacgccgaa
cgtctgcgtcgcgcggccaaggacgctgttgtgctgcatccgggcccgatcaaccgcggc
gtggagatcaccgacgaggtcgccgacggcgcgcaatcgtgcgtgctgcgccaggtcgcc
aacggtgtggcggtgcgtatggccgtgttggagacattgttgggctga

DBGET integrated database retrieval system