KEGG   Xanthomonas albilineans: XALC_2210Help
Entry
XALC_2210         CDS       T01160                                 

Gene name
cysQ
Definition
(GenBank) putative sulfite synthesis pathway protein
  KO
K01082  3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
xal  Xanthomonas albilineans
Pathway
xal00920  Sulfur metabolism
xal01100  Metabolic pathways
xal01120  Microbial metabolism in diverse environments
xal01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:xal00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    XALC_2210 (cysQ)
Enzymes [BR:xal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     XALC_2210 (cysQ)
Transfer RNA biogenesis [BR:xal03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    XALC_2210 (cysQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Inositol_P
Motif
Other DBs
NCBI-ProteinID: CBA16692
UniProt: D2UEU6
Position
complement(2607237..2608037)
Genome map
AA seq 266 aa AA seqDB search
MIPLTSNLRESVIAIARDAAAAIMQIYVTGFEVEHKADASPLTQADLTAHQLIVQGLERL
TPDLPVLSEESAQIPWDVRQQWTTYWLVDPLDGTREFVKRNGEFSVNIALIHRGVPVFGV
IQAPVDGRLWHAVHGEQAYRRDGLRDTALNTRRPAAAPLRVAASRSHRDPRTDALLQRMG
EIELVGQGSSLKFCRLADGELDVYPRFGPTSEWDTAAGQCVLQAAGGVLLAADTGKPFRY
NRRDCLLNGDFIALGDPALSWREWQG
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgatccctctgaccagcaatctgcgcgagagcgtcattgccatcgcccgtgatgccgcc
gcggcaatcatgcaaatctacgtcaccggtttcgaggtcgagcacaaggccgacgccagt
cccctgacccaggccgatctgacggcgcatcaactcattgtccaaggcctggagcggttg
accccggacttgccggtgctatcggaggaatcggcgcagatcccgtgggacgtgcgccag
caatggacgacatattggttggtggatccgctcgatggcacccgcgaattcgtcaagcgc
aacggcgagttcagcgtcaacatcgccctgatccatcggggggtgccggtgttcggtgtg
atccaggcgccggtggatggtcgcctctggcatgcggtgcatggtgagcaggcgtaccgc
cgcgatggcctgcgcgacaccgcactgaacacgcggcggccggcggcagctccgctgcgg
gtggcggcgagccgttcgcaccgcgatccgcgcaccgacgcgctgctgcaacggatgggc
gagatcgaactggtcgggcagggttcctcgctgaaattctgccgccttgccgatggcgaa
ttggatgtgtacccgcgtttcgggccgacctcggaatgggataccgcagccggtcaatgt
gtgctgcaagctgccggcggagtgctgttggctgccgacaccggcaaaccgttccgttac
aaccggcgcgattgcctgctcaatggcgactttattgcgcttggcgatcccgccctgtct
tggcgcgaatggcagggctga

DBGET integrated database retrieval system