KEGG   Xanthomonas albilineans: XALC_2215Help
Entry
XALC_2215         CDS       T01160                                 

Gene name
glk2
Definition
(GenBank) probable glucokinase protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
xal  Xanthomonas albilineans
Pathway
xal00010  Glycolysis / Gluconeogenesis
xal00052  Galactose metabolism
xal00500  Starch and sucrose metabolism
xal00520  Amino sugar and nucleotide sugar metabolism
xal00521  Streptomycin biosynthesis
xal01100  Metabolic pathways
xal01110  Biosynthesis of secondary metabolites
xal01120  Microbial metabolism in diverse environments
xal01130  Biosynthesis of antibiotics
xal01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:xal00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XALC_2215 (glk2)
   00052 Galactose metabolism
    XALC_2215 (glk2)
   00500 Starch and sucrose metabolism
    XALC_2215 (glk2)
   00520 Amino sugar and nucleotide sugar metabolism
    XALC_2215 (glk2)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    XALC_2215 (glk2)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    XALC_2215 (glk2)
Enzymes [BR:xal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     XALC_2215 (glk2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-ProteinID: CBA16697
UniProt: D2UEV1
Position
complement(2614007..2615029)
Genome map
AA seq 340 aa AA seqDB search
MPSTNSQMAAAVPCAEPFIAADVGGTHVRIALVARATTSGTAPAVELLDYRKYRCADYPG
LAEIIGEFLSGVSGPMPTRGVIASAGYALEDGRIITTNLPWTLSPPEIRERLGMQALHLV
NDFEAVAYAAASMDASEVLHLTGPRRAQRGPALVIGPGTGLGAAVWIPTGRGAVVLATEA
GHAALPAGSALELELVQRLLRTRGYVHVEHFLSGPGLINLYGALCELRQATPVHTEPSAI
TAAALAGDDALAHEALSTFCGLLGSVVGDMALLYGIHSGIYLAGGFLPQIADFLAASAFV
ERYLNKGAMRPALEQIPVKLVEHGRLGVIGAANWFLQQQG
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
gtgccctcaaccaattcacaaatggcagcggctgtgccgtgtgccgaacctttcattgct
gccgatgtcggtggaacccatgtgcggatcgcactggttgcgcgcgccacgaccagtggt
acggcaccggcggtggaattgctggactaccgcaaatatcgctgtgcggactatccgggc
ttggccgagatcatcggcgaattcctgtccggcgtgtccggcccgatgcccacccgtggc
gtgatcgccagcgccggctatgcgctggaggatggacggatcatcaccaccaatctgcca
tggacgctgtcgccgccggaaatccgcgagcgcctggggatgcaggcattgcatttggtc
aacgacttcgaagcggtggcgtatgcggccgcgtcgatggatgccagcgaagtgttgcac
ctcactgggccgcgtcgtgcgcaacgcggtccggcactggtgatcggtccgggcaccggg
ctcggcgctgcggtgtggattccgacgggtcgcggcgcggtggtgctggccaccgaggcc
gggcatgcggcgctaccggcgggcagcgccctggagctggagctggtgcagcgcttgctg
cgcacgcgcggctatgtgcatgtggaacactttctgtctggtccgggcttgatcaatctg
tatggcgccttgtgcgaattgcgtcaggccacgccggtccacaccgagccgagcgcgatc
accgctgcggcgctggcaggcgacgatgcgctggcgcacgaagccttgtcgacgttctgc
ggtctgctcggtagcgtggtcggcgatatggcactgctgtacggaatccacagtggcatc
tatctggccggtggcttcctgccgcagatcgccgatttcctcgctgccagtgcgttcgtc
gagcgttacttgaacaagggcgcgatgcgtccggcgctggaacagatcccggtgaagttg
gtcgaacacggtcggctcggcgttatcggcgcggcgaattggttcctgcagcagcaagga
tga

DBGET integrated database retrieval system