KEGG   Xanthomonas albilineans: XALc_2219Help
Entry
XALc_2219         CDS       T01160                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
xal  Xanthomonas albilineans
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xal00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    XALc_2219
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    XALc_2219
Enzymes [BR:xal01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     XALc_2219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2621510..2624005
Genome map
AA seq 831 aa AA seqDB search
MTVVGDHSRLPHRPMPACARIAAASRTAWLRLSLLALGALLGGCDRAPPPAPQAAPKPAS
KPAPAPKPRDHHNDDAPLPLIPAPAQAERDGDTLTFDSDSALSVAIDDAAAMRVAQQLAA
LLRKTRGLNVQVREETIPADGSIRLQLNPNTAVAQAEGYTLDVDSHTMLIQARDESGLFY
GAISAWQLLTPNADKGEVEVPQVHLRDWPRFGWRGLLLDVARHFHGPDTVKHVIDAMAQH
KLNVLHLHLTDDQGWRIEIKRYPKLTQIGAWRTPPGAGSHDLPNRYGGFYTQEQIRDLVA
YAADRHITIVPELDMPGHAQAAVAAYPELVGVTRQRPKVSVDWGVNPYLFNTDAKSMTFI
QGVLDEVLQLFPSTYIHIGGDEAVKDQWEHSAAVRAQMRKLRVKDAHAMQGWFNAQLADY
LTKHNRRLIGWDEILEGGLPASASVMSWRGVEGAVAAAKQGHDVVLAPAGWMYLDNLQSA
RNDEPNGRLSVLPLEKVYSFDPVPAALSADESKHVLGTQAALWTEYIPSAWHVDHALFPR
LSAVAEAAWSPMAARNWNSFLQRLPAQLDRYRTQGIDASDGAFAPDIAVQGGDNAALDSG
KATIVLSNQAKFGNFRYTTDGSEPKADSAHYTAPFAVPLPTTVRVATFADDGRVLAAARS
RILDRPNLLSRDTQGLGSCADGSLGLRVPLLPDLPGKDTPVFNIDLFTSCWRYADAGLDG
IARIRIDAARLARNYGLAHDQTKVKRYPAKSTHGEFEVHLGDCKGKLLARLPLPAGKTLG
EQFSLEARLPAQTGVHDLCLRSTAPIAGPYYAIGAVHLIDSAAQAPPAAAH
NT seq 2496 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcgtgggcgaccactcccgtttgccgcaccgcccgatgcccgcctgcgcgcgc
atcgcggcggcctcccgcaccgcctggctgcgcttgtccttgctcgcgcttggcgccttg
ctcggtggctgcgatcgcgccccaccacctgcgccacaggccgcacccaaacctgcatcg
aaaccggctcccgcaccgaagccgcgggaccaccacaacgatgacgcaccgttgccgctg
atcccggcaccggcgcaggccgaacgcgacggcgacacgctgaccttcgacagcgacagc
gcgctctcggtggccatcgacgacgcagcggcgatgcgcgtggcccaacaactggccgcg
ctgctgcgcaagacgcgcggtctgaacgtgcaggtgcgtgaggagaccatcccggccgac
ggcagcatccgcctgcaactcaaccccaacaccgcggtcgcgcaagcggagggctacacg
ctggacgtggactcgcacaccatgctgatccaggcccgcgacgaatccggcttgttctac
ggtgcgatcagcgcttggcaactgcttaccccgaatgccgacaagggcgaggtggaggtg
ccgcaagtgcatctccgcgactggccgcgcttcggctggcgtggcctgttgctcgatgtg
gcacggcatttccatggcccggacacggtcaagcacgtcatcgacgcgatggcgcagcac
aagctcaacgtcctgcatctgcacctgaccgacgaccagggctggcgcatcgagatcaag
cgctatcccaagctcacccagatcggcgcatggcgcaccccgcccggtgccggcagccac
gacctgcccaaccgctatggcggtttctacacccaggagcagatccgcgacctggtcgcc
tatgccgccgaccgacacatcaccatcgtgccggaactggacatgcccggacatgcgcag
gcagcggtcgcggcgtatccggaactggtcggggtcacccggcaacggcccaaggtgtcg
gtggactggggcgtcaacccctatctcttcaacaccgacgccaagagcatgaccttcatc
cagggcgtcctggacgaagtgctgcaactcttcccatcgacctacatccacatcggcggc
gacgaagcggtcaaggaccagtgggaacactcggcggcggtgcgtgcgcagatgcgcaag
ctccgcgtcaaggatgcgcatgcaatgcaaggctggttcaacgcgcaactggccgactat
ctgaccaaacacaaccgacgcctgatcggctgggacgaaatcctcgaaggcggcctgccc
gcgagcgcctcggtgatgtcctggcgcggtgtggaaggcgcggtcgccgcggccaagcaa
ggccacgacgtcgtcctggcacccgccggctggatgtacctggacaacctgcaaagcgct
cgcaacgacgaacccaatggccgcctgtcggtgttgccactggagaaggtctacagcttc
gatccagtgccggccgccctcagcgcagacgagagcaagcacgtgctaggcacccaagcg
gcgctgtggaccgagtacatcccctcggcatggcacgtggaccatgcgctgttcccacgg
ctgagcgcggtggccgaagccgcatggtcgccgatggccgcgcgtaattggaacagcttc
ctgcaacgcctgccggcacaactggaccgctatcgcactcagggcatcgacgccagcgac
ggcgccttcgcaccagacatcgcggtgcagggcggcgacaatgccgcgctcgacagcggc
aaggccaccatcgtgctgagcaatcaggccaagttcggcaacttccgttacaccaccgac
ggcagcgaacccaaggccgactcggcgcactacaccgcgccgttcgccgtgcccctgccg
accacggtgcgggtggccaccttcgccgacgacggccgcgtgctcgccgcagcgcgcagc
cgcatcctcgaccgccccaacctgctcagccgcgacacccagggcctgggttcgtgcgca
gacggctcgctgggcctgcgcgtgccattgctgcccgacctgcccggcaaagacaccccc
gtattcaacatcgatctgttcaccagttgctggcgctatgccgacgcgggcctggacggc
atcgcccgcattcgcatcgatgcggcgcggctggcgcgcaattatgggttggcgcacgac
cagaccaaggtcaagcgctatccggccaagagcacgcatggcgagttcgaagtgcatcta
ggcgattgcaagggcaagctcctggcgcggctgccgctgccggccggcaagaccctcggc
gagcagttctcgttggaagcgcggctgccggcgcagaccggcgtacacgacctgtgcctg
cgctccaccgcaccgatcgcaggcccttactacgccatcggcgccgtccatttgatcgac
agcgccgcgcaggcgccacccgccgccgcgcactga

DBGET integrated database retrieval system