KEGG   Xanthomonas albilineans: XALc_2221Help
Entry
XALc_2221         CDS       T01160                                 

Definition
beta-glucosidase (EC:3.2.1.21)
Orthology
K05349  
beta-glucosidase [EC:3.2.1.21]
Organism
xal  Xanthomonas albilineans
Pathway
Cyanoamino acid metabolism
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:xal00500]
Metabolism; Metabolism of other amino acids; Cyanoamino acid metabolism [PATH:xal00460]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2626751..2629465
Genome map
AA seq 904 aa AA seqDB search
MPRTPLHTPADHPQRRDAGSAGSRLSSLLRDIPQALCLLGLLVSPLAHADDAEDRATALV
AKMTRAEKIAQAMNDAPAIPRLGIPAYEWWSEGLHGIARNGEATVFPQAIGLAASWNTDL
LHAVGTVTSTEARAKFNLAGGPGKNHARYGGLTIWSPNINIFRDPRWGRGMETYGEDPYL
TGQLAVGFIHGLQGDDPTHPRTIATPKHLAVHSGPESGRHGFDVDVSPHDFEATYSPAFR
AAIVEGHAGSVMCAYNALHGIPACAADWLIDGRVRGNWGFKGFVVSDCDAIDDMTQFHYY
RADNAGSAAAALKAGHDLNCGYAYRDLGTALDRGEAEEAMLDRSLVRLFAARYRLGELQP
RSKDPYARLGAKDIDSPTHRALALQAAQQSLVLLQNRNDTLPLRPGLRLAVIGPNADALA
ALEANYQGTSVAPVTPLQGLRARFGTTQVHYTQGAPLAAGVPGTIPETALRSDGKPGLRG
EYFDNLDLAGRPRAQRQDRVIGFNWDHVAPAKGVDKDRYSVRWSGELLPPGPGDYTLAVR
VARCFDCAGHDPVRLYIDDQLVVAGNAEDKHVPAGMHNADGRNVETVLHFDDTQPHRIRL
ELEHRGQDQGLRLEWLAPPAAQLAEVEHAVAQADAVVAFVGLSPDVEGEELRIDVPGFDG
GDRNDLSLPAAQQALLERAKASGKPLIVVLMSGSAVALNWAKQHADAILAAWYPGQSGGT
AIAQALAGDINPGGRLPVTFYRSTKDLPPYVSYDMKGRTYRYFKGEALFPFGYGLSYTHF
AYTAPQLSSTTLQAGDTLHVTTTVRNTGARAGDEVVQVYLQYPPRAQSPLRALVGFQRVS
LQPGEARTLSFALEPRQLSDVDRSGQRAVEAGDYRLFVGGGQPDTQVSGSEAAFSIQGTT
PLPR
NT seq 2715 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgcacgccactgcacacgccagcggatcacccgcaacgacgcgatgccggcagc
gccggatcgcgactgtcgtcgctcctgcgcgacataccacaagcgctgtgcctgcttggg
ctgctcgtctcgccgctggcccatgccgacgacgccgaagaccgcgccaccgcgctggtg
gcgaagatgacccgcgcagaaaaaatcgcccaggcgatgaacgatgccccggccatcccg
cgcctgggcatccccgcctacgaatggtggagcgagggcctgcacggcatcgcccgcaac
ggcgaggccacggtgttcccgcaggccatcggcctggcggcgagttggaacaccgacctg
ctgcatgcagtcggcaccgtcacctcgaccgaagcacgcgccaaattcaacctcgctggc
ggccctggcaagaaccatgcgcgctatggcgggctgacgatctggtcgcccaacatcaac
atcttccgcgacccgcgctggggccgcggcatggagacctacggcgaggacccctatctc
accgggcagctcgcggtgggcttcatccacggcctgcagggcgacgacccaacgcatccg
cgcaccatcgccacgcccaagcatctggccgtgcacagcggaccggaatccggccgtcac
ggtttcgacgtggacgtctcgccgcacgatttcgaagccacgtattcccccgcattccgc
gccgccatcgtcgaggggcatgccggctcggtgatgtgcgcctacaacgcactgcacggc
atcccggcctgtgccgccgactggctcatcgacggccgcgtgcgcggcaactggggcttc
aagggtttcgtcgtctccgattgcgacgccatcgacgatatgacccagttccactactac
cgcgccgacaacgccggctctgccgccgccgcgctcaaggctggccacgatctgaactgc
ggctacgcctaccgcgatctcgggaccgcgctcgaccgcggcgaggccgaggaggccatg
ctggaccgctcgctggtgcggctgttcgccgcgcgctaccgactgggcgaattgcagccg
cgcagcaaagatccgtatgcccgactcggcgccaaagacatcgatagccccacgcaccgc
gcgctggcgctgcaagcggcgcagcaatcgctggtgctgctgcaaaatcgcaacgacacc
ctaccgctgcggccagggctgcgtctggcggtgatcggccccaatgccgatgcactggcg
gcactggaagccaactaccaaggcacctcggtggcaccagtgacgccactgcaaggcctg
cgtgcgcgctttggcaccacgcaagtgcactatacgcagggcgcgccgctggctgcgggc
gtaccgggcacgatccccgagaccgcgctccgcagcgacggcaagcccggtctgcgtggc
gaatatttcgacaacctggatctggccggtcgcccgcgcgcgcaacgccaggatcgggtg
atcggcttcaactgggaccacgtggcgccggccaagggcgtggacaaagatcgctactcg
gtacgctggagcggcgaactgctgccgcccggcccgggcgactacaccctggcggtgcgg
gtggcgcgctgtttcgactgtgctggccacgatccggtgcgcttgtacatcgacgatcaa
ttggtcgtcgccggcaacgccgaagacaaacacgtgccagccggcatgcataacgccgat
ggccgcaacgtggaaaccgtgctgcatttcgacgacacccagccacaccgcatccgtctg
gaactggaacaccgtggccaggaccagggactgcgcctggaatggctggcaccaccagcg
gcgcaattggccgaggtcgaacacgcggtggcgcaggccgacgcggtcgtggccttcgtc
ggtctatcgccggatgtggaaggcgaagaactgcgcatcgacgtgcccggcttcgacggc
ggcgaccgcaacgacctgtccctgcccgcggcacagcaggcgctgctggagcgcgccaag
gccagcggcaagccgttgatcgtggtgctgatgagcggcagcgcggtggcgctgaactgg
gccaaacaacacgccgacgcgatcctagcggcctggtatcccggacaatccggcggcacc
gcgatcgcacaggcgctggccggcgacatcaaccccggcgggcgcctgccggtgaccttc
taccgctcgaccaaggatctgccgccctacgtcagctacgacatgaagggccgcacctac
cgctatttcaagggcgaagcgttgttcccgttcggttacggcctgagctatacccacttc
gcctacaccgccccccagttgtcgagcacgacgctgcaagccggcgacaccttgcacgtc
accaccaccgtgcgcaacaccggcgcacgcgccggcgacgaggtggtgcaggtgtacctg
caatatccgccgcgtgcacagtcgccactgcgggcgctggtcggttttcagcgggtgagc
ctgcaaccgggcgaagcacgcaccctgagcttcgccctggagccgcgccagctcagcgac
gtggatcgcagtggccagcgcgcggtcgaggccggcgactaccggctattcgtcggcggt
ggtcagccggacacgcaagtgtctggcagtgaagcggcgttttcgattcagggcacgacg
ccattgccacgatga

DBGET integrated database retrieval system