KEGG   Xanthomonas albilineans: XALc_2430Help
Entry
XALc_2430         CDS       T01160                                 

Gene name
RuvA
Definition
holliday junction resolvasome, DNA-binding subunit protein
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
xal  Xanthomonas albilineans
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:xal00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    XALc_2430 (RuvA)
Enzymes [BR:xal01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     XALc_2430 (RuvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2887843..2888427)
Genome map
AA seq 194 aa AA seqDB search
MIGRLRGILAYKQPPWLVIDVGGVGYEMEAPMSTFYDLPDVGREVILFTHYAHKEDSVAL
YGFLREGERRLFRDVQRVTGIGAKIALAVLSGVSVDAFARLITAADVTALTRIPGIGKKT
AERMVVELRDRAADFSGGAPITGQLGADAVSEATSALQQLGYKPAEAAKMAREAAADGDE
VAMVIRKALQSALR
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgatcggtcgtctgcgcggtatcctcgcctacaaacagccgccatggttggtgatcgac
gtcggcggtgtcggttacgaaatggaggcgccaatgagcaccttctacgacctgcccgac
gtcggtcgcgaggtcatcctgttcacccactacgcgcacaaggaggacagtgtcgcgttg
tacggtttcctgcgcgagggcgagcggcgcctgttccgcgatgtgcaacgggtcaccggc
atcggggcgaagatcgccttggcggtactgtccggggttagcgtggacgcgttcgcccgg
ctgatcaccgccgccgacgttaccgcattgacccgtattcccggcatcggcaagaagacc
gccgagcggatggtggtggagttgcgcgaccgcgcggcggacttcagcggcggcgcaccg
atcactgggcaactgggtgccgatgcggtctccgaggccacatcggcgctgcagcagctt
ggctacaagcctgctgaagcggcgaagatggcgcgcgaggccgccgccgatggcgacgag
gtcgccatggtcattcgcaaggcgctgcagtcggcgcttcgctga

DBGET integrated database retrieval system