KEGG   Xanthomonas albilineans: XALc_2495Help
Entry
XALc_2495         CDS       T01160                                 

Definition
fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
xal  Xanthomonas albilineans
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:xal01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:xal01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2963897..2964814
Genome map
AA seq 305 aa AA seqDB search
MLRTLRQWFDTNAQIELDPARADRIDWLRATPYIGLHLACLGVFWVGVSGCAVGVALALY
AVRMFALTGFYHRYFAHRAFKTSRPVQFLFAALGATCVQRGPLWWAAHHRNHHRHTDTAA
DPHSPRQHGFWWSHSGWFLTPRGFRTDWEAIPDLRRFPELRFIDRFDLLIPVLLALAIFL
LGQWLQRHVPQLGTDGPQLLVWGFFVSTVALFHATFTINSLAHRFGSRRFDTRDDSRNNL
WLALLTFGEGWHNNHHFFPGAARQGFRWWEVDTTWYGLKAMAWIGLIRELKPVPAGLLRA
KERTR
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
gtgctgcgcacgctgcgccagtggttcgacaccaacgcgcagatcgagttggacccggcg
cgcgccgaccgcatcgactggctgcgggcgaccccctatatcggcctgcatctggcctgc
ctgggcgttttctgggtcggcgtgtcgggatgcgcggtgggtgtggcgctggccctgtac
gcagtgcgcatgttcgctctcaccggcttctaccaccgctatttcgctcaccgcgcgttc
aagacctcgcgcccagtgcagttcctgttcgccgcgctcggcgccacttgcgtgcaacgt
gggccactgtggtgggccgcgcaccatcgcaatcaccatcgccacaccgacaccgcggcc
gatccacactccccgcgccagcatggtttctggtggagtcatagcggctggttcctgacc
ccacgcggtttccgcaccgactgggaggcgattcccgacctgcgccgtttccctgaactt
cgctttattgatcgcttcgacctgctaataccggtactgctggcactggcaatattcctg
ctcggccaatggctgcagcggcatgtgccgcaactgggcaccgacggcccgcagttactg
gtgtggggctttttcgtttccaccgtggccttgttccatgcgaccttcaccatcaactcg
ctggcgcaccgcttcggcagccgtcgtttcgacacccgcgacgacagccgcaacaatctc
tggctagcactgctgaccttcggcgagggctggcacaacaaccaccactttttccccggc
gcggcgcgccagggcttccgctggtgggaagtggacacgacctggtacggcctgaaggcc
atggcgtggatcggcctgatccgcgaactcaagccggtgccagcggggctgctgcgcgcg
aaggaacggacacgatga

DBGET integrated database retrieval system