KEGG   Xanthomonas albilineans: XALC_2495Help
Entry
XALC_2495         CDS       T01160                                 

Definition
(GenBank) putative fatty acid desaturase protein
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
xal  Xanthomonas albilineans
Pathway
xal01040  Biosynthesis of unsaturated fatty acids
xal01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:xal00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    XALC_2495
Enzymes [BR:xal01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     XALC_2495
Lipid biosynthesis proteins [BR:xal01004]
 Desaturase
  First
   XALC_2495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase
Motif
Other DBs
NCBI-ProteinID: CBA16974
UniProt: D2U9M2
Position
2963897..2964814
Genome map
AA seq 305 aa AA seqDB search
MLRTLRQWFDTNAQIELDPARADRIDWLRATPYIGLHLACLGVFWVGVSGCAVGVALALY
AVRMFALTGFYHRYFAHRAFKTSRPVQFLFAALGATCVQRGPLWWAAHHRNHHRHTDTAA
DPHSPRQHGFWWSHSGWFLTPRGFRTDWEAIPDLRRFPELRFIDRFDLLIPVLLALAIFL
LGQWLQRHVPQLGTDGPQLLVWGFFVSTVALFHATFTINSLAHRFGSRRFDTRDDSRNNL
WLALLTFGEGWHNNHHFFPGAARQGFRWWEVDTTWYGLKAMAWIGLIRELKPVPAGLLRA
KERTR
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
gtgctgcgcacgctgcgccagtggttcgacaccaacgcgcagatcgagttggacccggcg
cgcgccgaccgcatcgactggctgcgggcgaccccctatatcggcctgcatctggcctgc
ctgggcgttttctgggtcggcgtgtcgggatgcgcggtgggtgtggcgctggccctgtac
gcagtgcgcatgttcgctctcaccggcttctaccaccgctatttcgctcaccgcgcgttc
aagacctcgcgcccagtgcagttcctgttcgccgcgctcggcgccacttgcgtgcaacgt
gggccactgtggtgggccgcgcaccatcgcaatcaccatcgccacaccgacaccgcggcc
gatccacactccccgcgccagcatggtttctggtggagtcatagcggctggttcctgacc
ccacgcggtttccgcaccgactgggaggcgattcccgacctgcgccgtttccctgaactt
cgctttattgatcgcttcgacctgctaataccggtactgctggcactggcaatattcctg
ctcggccaatggctgcagcggcatgtgccgcaactgggcaccgacggcccgcagttactg
gtgtggggctttttcgtttccaccgtggccttgttccatgcgaccttcaccatcaactcg
ctggcgcaccgcttcggcagccgtcgtttcgacacccgcgacgacagccgcaacaatctc
tggctagcactgctgaccttcggcgagggctggcacaacaaccaccactttttccccggc
gcggcgcgccagggcttccgctggtgggaagtggacacgacctggtacggcctgaaggcc
atggcgtggatcggcctgatccgcgaactcaagccggtgccagcggggctgctgcgcgcg
aaggaacggacacgatga

DBGET integrated database retrieval system