KEGG   Xanthomonas albilineans: XALC_2548Help
Entry
XALC_2548         CDS       T01160                                 

Gene name
fadJ
Definition
(GenBank) probable fatty acid oxidation complex, alpha subunit fadj protein
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
xal  Xanthomonas albilineans
Pathway
xal00071  Fatty acid degradation
xal00280  Valine, leucine and isoleucine degradation
xal00281  Geraniol degradation
xal00310  Lysine degradation
xal00362  Benzoate degradation
xal00380  Tryptophan metabolism
xal00410  beta-Alanine metabolism
xal00640  Propanoate metabolism
xal00650  Butanoate metabolism
xal00903  Limonene and pinene degradation
xal00930  Caprolactam degradation
xal01040  Biosynthesis of unsaturated fatty acids
xal01100  Metabolic pathways
xal01110  Biosynthesis of secondary metabolites
xal01120  Microbial metabolism in diverse environments
xal01130  Biosynthesis of antibiotics
xal01200  Carbon metabolism
xal01212  Fatty acid metabolism
Module
xal_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:xal00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    XALC_2548 (fadJ)
   00650 Butanoate metabolism
    XALC_2548 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    XALC_2548 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    XALC_2548 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    XALC_2548 (fadJ)
   00310 Lysine degradation
    XALC_2548 (fadJ)
   00380 Tryptophan metabolism
    XALC_2548 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    XALC_2548 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    XALC_2548 (fadJ)
   00281 Geraniol degradation
    XALC_2548 (fadJ)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    XALC_2548 (fadJ)
   00930 Caprolactam degradation
    XALC_2548 (fadJ)
Enzymes [BR:xal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     XALC_2548 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     XALC_2548 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     XALC_2548 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 ECH_2 3HCDH Pyr_redox_2 NAD_binding_2 ApbA MORN DLH
Motif
Other DBs
NCBI-ProteinID: CBA17027
UniProt: D2U9S5
Position
3022236..3024299
Genome map
AA seq 687 aa AA seqDB search
MVSGFDGLRFSHWQADIRDDGVVVLSLDRQDAPVNALSQAVLLELDDLLDRIAIDPPRGV
VIRSAKPNGFIAGADLKEFQEFDRRGTVNDAIRRGQATFQKLAELPCPTVAAIHGFCMGG
GTEIALACRFRIASSDASTRIGLPETKLGIFPGWGGSARLPQLIGAPAAMDLMLTGRTVS
ATAARALGLIDKIAAPAMLTDNAVTLALSGSARPFQQRVTAWATNTWPARKLLAPQMRKQ
VARKARKEHYPAPYALIDVWERTGGSDIQARLDAERKAVVKLAGTPTAHNLIRIFFLTER
LKSLGGKEHGIRHVHVVGAGVMGGDIAAWSAYKGFEVTLQDREQRFIDGALRRAGDLFAK
RVKDDSKRPEVAARLKSDLSGDGVSTADLVIEAIIENPQAKCDLYRELEPQMQPNALLST
NTSSIPLNELREQLQHPAQFGGLHYFNPVAQMPLVEIVCHDALPPENQNRLAAFCKAIDK
LPVPVAGTPGFLVNRVLFPYMLEAATAYAEGIPGPAIDKVAVKFGMPMGPIELLDTVGLD
VAAGVGAELAPFLGLPIPAALQTVQPGKRGKKDGKGLYVWENGRAKKPELTKDYRAPDDL
EDRLILPLLNEAVACLHDDVVADADLLDAGVIFGTGFAPFRGGPIQYIRAAGADTLLARL
RTLQARYGERFAPRPGWDSPALREAPV
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atggtctcaggcttcgatgggctccgattcagtcactggcaagcggacatccgcgacgac
ggggtcgtcgtactcagcctcgatcgccaggacgcgcccgtcaatgcgctgtcgcaggcc
gtcctgctggaactggacgacctgctcgaccgcattgccatcgatccgcccaggggcgtg
gtgatccgctcggccaaacccaatggcttcatcgccggcgccgacctcaaagagttccag
gaattcgaccgccgcggcaccgtcaacgacgcgatccggcgtggtcaggccaccttccag
aagctggcggaattgccctgccccaccgtcgctgcgatccatggcttctgcatgggcggc
ggcaccgagatcgcgctggcctgccgcttccggatcgcctccagcgatgcgtccacgcgc
atcggcctgcccgagaccaaactcggcatcttccccggctggggcggcagcgcgcgcctg
ccacaattgatcggcgcaccggcggcgatggatctgatgctcaccgggcgtaccgtgtcg
gcaacggcggcgcgggcgctcggcctgatcgacaagatcgccgcgccggccatgctgacc
gataacgcggtgacgctggccctgtccggcagcgcacggccattccagcagcgtgtcact
gcctgggccaccaatacctggccggcgcgcaaactgctggcgccgcagatgcgcaagcag
gtcgcgcgcaaggcacgaaaagaacactacccggcgccgtatgcgctgatcgacgtgtgg
gagcgcaccggcggcagcgacattcaggcacgtctggacgccgagcgcaaagcggtggtc
aagctggccggcacaccgaccgcgcacaacttgattcgcattttcttcctcaccgaacgg
ctcaagtcgctaggcggcaaggaacacggcatccgccatgtacacgtagtcggcgctggc
gtgatgggtggcgacatcgcggcgtggtctgcctacaagggcttcgaagtgaccctgcaa
gaccgcgaacagcgtttcatcgatggcgcgctacgccgtgccggcgacctgtttgccaag
cgcgtcaaggacgacagcaagcgcccggaggtggcggcacgcttgaaaagcgacctgagc
ggcgacggcgtatcgacagccgacctggtgatcgaagccatcatcgaaaacccgcaagcc
aagtgcgacctgtatcgagagctggaaccacagatgcagccgaacgcgctgctcagcacc
aacacgtcctcgattccgttgaacgagttacgcgaacaactccagcacccggcgcagttc
ggcggcttgcattacttcaacccagtggcgcaaatgccattggtggaaatcgtctgccac
gacgccctgccgccggaaaatcaaaaccgcctggcggcattctgcaaggcgatcgacaag
ctgccggtgccggtcgccggcactccgggattcctggtcaaccgggtgctgttcccgtac
atgttggaagcggccaccgcatatgccgagggcattcccggccctgcgatcgataaggtc
gcggtgaagttcggcatgccgatgggcccgatcgaactcctcgacaccgtcggcctggac
gtggccgctggcgtcggcgcggagctggcgccattcctgggcctgccgattccggcggcg
ctacagacggtgcagccgggcaagcgcggcaagaaggacggcaagggcctgtacgtctgg
gaaaacggtcgcgccaagaaacccgaattgaccaaggactaccgcgcgccggacgatctg
gaagaccgcctgatcctgccgttgctcaacgaagcggtggcatgcctgcacgacgacgtg
gtcgccgatgccgatctgctggatgccggagtgatcttcggcaccggcttcgcgccattc
cgtggcggcccgatccagtacatccgcgccgccggtgccgacacactgctggcacgcttg
cgcacgctgcaagcgcgctacggcgagcgcttcgcaccgcgcccaggttgggattcgccg
gcattacgcgaagcgccggtctga

DBGET integrated database retrieval system