KEGG   Xanthomonas albilineans: XALc_2593Help
Entry
XALc_2593         CDS       T01160                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
xal  Xanthomonas albilineans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xal00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    XALc_2593
Enzymes [BR:xal01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     XALc_2593
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3073325..3075301
Genome map
AA seq 658 aa AA seqDB search
MTDAALHTLASAAGLLVNWIDASDIPRTVGADTLRLVLNTLGLDARDNTACRDSLRRLQA
DTATPPLLTTDPDAALDIGATPGTAYRLEREDGLHLEGHFDAHGRLAAPAAPGYWALLHG
ERRTTVAVAPPRCYSVADAVGIHDPRRWGLSLQVYSTQGAHDAGIGDADGVATWVTRIAA
AGGDAIALSPVHAAAPVGTHYSPYSPSDRRFLDPLQAAPAHVLGTLATQRAIETAGLTQS
FAAAQARPLIDWPASATAKWRCLRQLHADFGHADAALHADLANFEHDGGTALREYAIFAA
HAFGDTDPALHRFAQWLAARSWASVQRQARAAGMGIGLIADLAVGFDPHGAEAAAWPEAV
LHGLELGAPPDAFNRDGQAWGISGYAPNALRASGYAPFIALLRAVLRDRGGVRIDHILGL
LRLWVIPSGTSSTDGVYLRYPLHDLLRLLALESWRHRAIVIGEDLGVVPDGIRTELSQRG
VMGIDVLLFTRDPNGAFLPPMQWRHDAIATTTTHDLPTLRGWCQGKDIDWRARLQLCDAT
QQRIDHLTRHADVAQMERACAAALPPGQTIDPEQMALCFVGATPSPLALLPAEDALGLDQ
QPNLPGTIDGHPNWRRRLQSPDADTTATTLATRLDAFAQTRRHASVTATDAPTTDACA
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgccgcactgcataccctggccagcgctgccggcctgctggtgaactggatc
gatgccagcgacatcccgcgcacggtcggcgcagacacactacgcctggtactgaacacg
ctgggcctggacgcacgcgacaacaccgcctgccgcgacagtctgcgccgactacaggcc
gataccgccacaccgccattgctgaccacagacccggacgcggcgctcgacatcggcgct
acacccggcacggcgtaccgactggaacgcgaagacggcttgcacctggaaggccatttc
gatgcacatggtcgcctcgctgcacccgccgcacccggctactgggccctactgcatggc
gaacgccgcaccaccgtggcggtggcgccgccgcgctgctacagcgtcgccgacgcagtc
ggcatccacgacccgcggcgttgggggctatcgctacaggtctattcgacacaaggtgcg
cacgacgccggcattggcgatgcagacggcgtggccacctgggtcacacgcatcgccgca
gccggtggcgatgccatcgccctcagcccggtccacgcggcggctccggtcggcacgcac
tacagcccgtattcgccgagcgaccgccgtttcctcgacccactgcaagccgcaccggcg
cacgtcctcggcacgctcgccacgcagcgcgccatagaaacagccggactgacgcagagc
ttcgccgcggcacaggcacgcccgctgatcgactggcccgcctcggccacagcaaaatgg
cgctgcttgcgtcagttgcatgccgatttcggccacgccgacgccgcactgcacgcggac
ctggcgaacttcgagcacgatggcggaaccgcgctgcgcgaatacgccatcttcgccgcg
cacgccttcggcgataccgatccggccctgcatcgcttcgcgcagtggctggccgcacgc
agttgggccagcgtgcagcggcaggcgcgggcagccggcatgggcatcggcctgatcgcc
gacctggcggtgggcttcgacccacacggcgccgaagccgcggcctggccagaagcggtg
ttacatggcctggaacttggcgcccccccggatgcgttcaaccgcgacggccaggcctgg
ggcatcagcggctatgcgccgaacgcactgcgtgccagcggctatgcgcccttcatcgcc
ctgttgcgcgcggtactgcgcgaccgtggcggcgtgcgcatcgaccatattctgggcctg
ctgcgactgtgggtaatcccaagtggcacgtcctccaccgatggcgtgtatctgcgctat
ccactgcacgacctgctgcgcctgctggcgttggaatcgtggcggcaccgcgccatcgtg
atcggcgaagacctgggcgtggtgccggacggcatccgcacagagctgtcccaacgcggc
gtgatgggcatcgacgtactgctgttcactcgcgacccaaacggcgcctttctgccaccg
atgcagtggcgccacgacgccatcgccaccaccaccacccacgatctgccgaccctacgc
ggctggtgccaaggcaaggacatcgactggcgcgcacgcctgcagttgtgcgatgccacc
cagcaacgcatcgaccatctgacacggcatgcggatgtggcacagatggaacgcgcctgt
gccgccgcactgccgccgggacaaaccatcgacccggaacagatggcactgtgcttcgtc
ggcgccacaccttcgccgctggcgctgttgcccgccgaggacgcactcggcctggaccag
caacccaacctgcccggcaccatcgacggccatccgaactggcgtcgacgcctgcaatcc
cccgacgcggacaccaccgcgacaacgctggcgacgcgcctagatgccttcgcgcagaca
cgccgccacgcatccgtcaccgccactgacgcgccaaccaccgacgcatgtgcatga

DBGET integrated database retrieval system