KEGG   Xanthomonas albilineans: XALC_2674Help
Entry
XALC_2674         CDS       T01160                                 

Gene name
holC
Definition
(GenBank) probable dna polymerase III subunit chi protein
  KO
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
xal  Xanthomonas albilineans
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:xal00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    XALC_2674 (holC)
   00240 Pyrimidine metabolism
    XALC_2674 (holC)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    XALC_2674 (holC)
   03430 Mismatch repair
    XALC_2674 (holC)
   03440 Homologous recombination
    XALC_2674 (holC)
Enzymes [BR:xal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     XALC_2674 (holC)
DNA replication proteins [BR:xal03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     XALC_2674 (holC)
DNA repair and recombination proteins [BR:xal03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     XALC_2674 (holC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3171294..3171716
Genome map
AA seq 140 aa AA seqDB search
MRADFYLIAKPRFLTAPLRLVCELARKANDANLWTLVLARDLAQAEELDELLWAFDDDAY
IPHQIAGADADEEEAQVLIAPPEVDAASRPLVINLRDAPYLGTCERVLEVVPADLSAREP
LRERWKQYKTQGYAVNKYDM
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccgacttctacctgatcgccaagccacggttcctcactgcaccgctgcggctg
gtatgcgagctggcgcgcaaggccaacgacgccaacctgtggacgctggtgctggcgcgc
gacctggcccaggccgaggaactggacgaactgctttgggcgttcgacgacgacgcctat
atcccccaccagatcgccggtgccgacgcggacgaagaggaggcgcaggtgttgatcgcc
cctccagaagtggacgcagcatcgcgaccactggtcatcaacctgcgcgacgcgccctat
ttgggcacctgcgagcgcgtcctggaagtggtaccggccgacctctccgcgcgcgaaccg
ctgcgcgagcgctggaagcagtacaaaacgcagggctacgcagtcaacaagtacgacatg
tga

DBGET integrated database retrieval system