KEGG   Xanthomonas albilineans: XALC_2692Help
Entry
XALC_2692         CDS       T01160                                 

Gene name
xanA
Definition
(GenBank) probable phosphoglucomutase / phosphomannomutase protein (EC:5.4.2.2)
  KO
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
xal  Xanthomonas albilineans
Pathway
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:xal00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XALC_2692 (xanA)
   00030 Pentose phosphate pathway
    XALC_2692 (xanA)
   00051 Fructose and mannose metabolism
    XALC_2692 (xanA)
   00052 Galactose metabolism
    XALC_2692 (xanA)
   00500 Starch and sucrose metabolism
    XALC_2692 (xanA)
   00520 Amino sugar and nucleotide sugar metabolism
    XALC_2692 (xanA)
  Nucleotide metabolism
   00230 Purine metabolism
    XALC_2692 (xanA)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    XALC_2692 (xanA)
Enzymes [BR:xal01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     XALC_2692 (xanA)
    5.4.2.8  phosphomannomutase
     XALC_2692 (xanA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3191143..3192489
Genome map
AA seq 448 aa AA seqDB search
MSLPAFKAYDIRGRVPDELNEDLARRIGVALAGQLQSGPVVVGHDVRLASPSLQAALSAG
LRASGREVIDIGLCGTEEVYFQTDHLQAAGGVMVTASHNPMDYNGMKLVREHARPISSDT
GLFAIRDTVAADTAPAGTPIAAEHQRPDKSAYIAHLLSYVDSATLKPLKLVVNAGNGGAG
AIVDLLAPHLPFEFVRVFHEPDGHFPNGIPNPLLSENRAATANAVKQHGADFGIAWDGDF
DRCFFFDANGRFIEGYYLVGLLAQAILAKQPGGKIVHDPRLTWNTIEMVEDAGGIPVLCK
SGHAFIKEKMRSENAVYGGEMSAHHYFREFAYADSGMIPWLLIAELVSQSGRSLADLVEA
RMQKFPCSGEINFKVADAKAAVARVMQHYAAQSPALDYTDGVSAEFAQWRFNLRSSNTEP
LLRLNVETRGDAALLEQRTREISDLLNA
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcttcccgcattcaaggcctacgacatccgcggtcgcgtgcccgacgaactgaac
gaagatctggcacgccgcatcggcgtggcgttggcagggcagttgcagagcgggccggtg
gtggtgggacacgatgtgcgcctagcgagcccgtcgctacaggcggcactgtcagcgggc
ttgcgcgccagcggccgcgaggtgatcgacatcggcctgtgcggcaccgaggaagtgtat
ttccaaaccgaccacctgcaggccgctggcggcgtgatggtcaccgccagccacaacccg
atggactacaacggcatgaagctggtccgcgagcacgcgcgtccgatcagttccgacacc
ggcctgttcgccatccgcgacaccgtggccgccgataccgcacccgccggcacaccgatt
gccgccgaacaccaacgcccggacaagtccgcctacatcgcgcacctgctcagctacgtc
gacagcgccacgctcaaaccgttgaagctggtggtcaacgccggcaacggcggcgccggc
gccatcgtcgatctgctggcaccacacctgccattcgagttcgtccgcgtgtttcacgag
ccggacggccatttccccaatggcattcccaacccactgctgtcggaaaaccgcgccgcc
accgccaacgcggtcaagcagcacggcgcggacttcggcatcgcctgggatggcgatttc
gaccgttgcttcttcttcgacgccaacggccgcttcatcgagggctactacctggtgggc
ttgctggcgcaggcgattctggccaagcagcccggcggcaagatcgtgcacgatccgcgc
ctgacttggaacacgatcgaaatggtcgaggacgctggcggcatcccagtgctgtgcaaa
agcgggcacgccttcatcaaagagaaaatgcgcagcgagaatgcggtgtatggcggcgag
atgagcgcacaccattatttccgcgagttcgcctacgccgactcgggcatgatcccctgg
ttgctgatcgccgaattggtgtcgcaatcggggcgttcactggccgacctggtcgaggcg
cggatgcagaagttcccatgcagcggcgagatcaacttcaaagtcgccgacgcgaaagcg
gccgtggcgcgggtgatgcagcactatgcggcgcagtcgcccgcgctggactacaccgac
ggcgtcagcgccgaattcgcgcaatggcgtttcaacctacgcagctccaatacagaaccg
ctgctgcggctaaacgtggaaacgcgcggcgatgcggccctgctggaacaacgcacgcga
gaaatttccgatctattgaacgcctga

DBGET integrated database retrieval system