KEGG   Xanthomonas albilineans: XALc_2692Help
Entry
XALc_2692         CDS       T01160                                 

Gene name
xanA
Definition
phosphoglucomutase/phosphomannomutase (EC:5.4.2.2)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
xal  Xanthomonas albilineans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:xal00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XALc_2692 (xanA)
   00030 Pentose phosphate pathway
    XALc_2692 (xanA)
   00051 Fructose and mannose metabolism
    XALc_2692 (xanA)
   00052 Galactose metabolism
    XALc_2692 (xanA)
   00500 Starch and sucrose metabolism
    XALc_2692 (xanA)
   00520 Amino sugar and nucleotide sugar metabolism
    XALc_2692 (xanA)
  Nucleotide metabolism
   00230 Purine metabolism
    XALc_2692 (xanA)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    XALc_2692 (xanA)
Enzymes [BR:xal01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     XALc_2692 (xanA)
    5.4.2.8  phosphomannomutase
     XALc_2692 (xanA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3191143..3192489
Genome map
AA seq 448 aa AA seqDB search
MSLPAFKAYDIRGRVPDELNEDLARRIGVALAGQLQSGPVVVGHDVRLASPSLQAALSAG
LRASGREVIDIGLCGTEEVYFQTDHLQAAGGVMVTASHNPMDYNGMKLVREHARPISSDT
GLFAIRDTVAADTAPAGTPIAAEHQRPDKSAYIAHLLSYVDSATLKPLKLVVNAGNGGAG
AIVDLLAPHLPFEFVRVFHEPDGHFPNGIPNPLLSENRAATANAVKQHGADFGIAWDGDF
DRCFFFDANGRFIEGYYLVGLLAQAILAKQPGGKIVHDPRLTWNTIEMVEDAGGIPVLCK
SGHAFIKEKMRSENAVYGGEMSAHHYFREFAYADSGMIPWLLIAELVSQSGRSLADLVEA
RMQKFPCSGEINFKVADAKAAVARVMQHYAAQSPALDYTDGVSAEFAQWRFNLRSSNTEP
LLRLNVETRGDAALLEQRTREISDLLNA
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcttcccgcattcaaggcctacgacatccgcggtcgcgtgcccgacgaactgaac
gaagatctggcacgccgcatcggcgtggcgttggcagggcagttgcagagcgggccggtg
gtggtgggacacgatgtgcgcctagcgagcccgtcgctacaggcggcactgtcagcgggc
ttgcgcgccagcggccgcgaggtgatcgacatcggcctgtgcggcaccgaggaagtgtat
ttccaaaccgaccacctgcaggccgctggcggcgtgatggtcaccgccagccacaacccg
atggactacaacggcatgaagctggtccgcgagcacgcgcgtccgatcagttccgacacc
ggcctgttcgccatccgcgacaccgtggccgccgataccgcacccgccggcacaccgatt
gccgccgaacaccaacgcccggacaagtccgcctacatcgcgcacctgctcagctacgtc
gacagcgccacgctcaaaccgttgaagctggtggtcaacgccggcaacggcggcgccggc
gccatcgtcgatctgctggcaccacacctgccattcgagttcgtccgcgtgtttcacgag
ccggacggccatttccccaatggcattcccaacccactgctgtcggaaaaccgcgccgcc
accgccaacgcggtcaagcagcacggcgcggacttcggcatcgcctgggatggcgatttc
gaccgttgcttcttcttcgacgccaacggccgcttcatcgagggctactacctggtgggc
ttgctggcgcaggcgattctggccaagcagcccggcggcaagatcgtgcacgatccgcgc
ctgacttggaacacgatcgaaatggtcgaggacgctggcggcatcccagtgctgtgcaaa
agcgggcacgccttcatcaaagagaaaatgcgcagcgagaatgcggtgtatggcggcgag
atgagcgcacaccattatttccgcgagttcgcctacgccgactcgggcatgatcccctgg
ttgctgatcgccgaattggtgtcgcaatcggggcgttcactggccgacctggtcgaggcg
cggatgcagaagttcccatgcagcggcgagatcaacttcaaagtcgccgacgcgaaagcg
gccgtggcgcgggtgatgcagcactatgcggcgcagtcgcccgcgctggactacaccgac
ggcgtcagcgccgaattcgcgcaatggcgtttcaacctacgcagctccaatacagaaccg
ctgctgcggctaaacgtggaaacgcgcggcgatgcggccctgctggaacaacgcacgcga
gaaatttccgatctattgaacgcctga

DBGET integrated database retrieval system