KEGG   Xanthomonas albilineans: XALc_2737Help
Entry
XALc_2737         CDS       T01160                                 

Gene name
hmgA
Definition
homogentisate 1,2-dioxygenase (EC:1.13.11.5)
Orthology
K00451  
homogentisate 1,2-dioxygenase [EC:1.13.11.5]
Organism
xal  Xanthomonas albilineans
Pathway
Tyrosine metabolism
Styrene degradation
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:xal00350]
Metabolism; Xenobiotics biodegradation and metabolism; Styrene degradation [PATH:xal00643]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3245669..3246970)
Genome map
AA seq 433 aa AA seqDB search
MHFDSLRYQSGFGNEFASEAVAGALPVGQNSPQRVAHGLYAEQLSGTAFTAPRATNRRSW
LYRIRPALLHGGFVAYTQAYGFHNAFQDGPVSPDQLRWSPLPLPEASLDFVDGLYTMAGN
GSAEAQHGVAVHLYAANASMQGRFFYDADAELLIVPQLGRLRVCTELGTLEVAPQEIVVI
PRGVRFRVALPDGPSRGYVCENFGALLRLPELGPIGANGLANPRDFLTPVAAYEEDEGDF
VLIAKFQGHLWQAPIGHSPLDVVAWHGNYAPYKYDLRRFNAIGSISFDHPDPSIFTVLTA
PSDTPGTANVDLAIFPPRWLVAQHTFRPPWFHRNVASEFMGLVYGAYDAKAEGFVPGGAS
LHNCMSGHGPDAATFDRASQADLTRPDVIADTMAFMFETRAVLRPTSQALEAAHRQRDYR
QCWQGLRRHFRAP
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgcacttcgattcccttcgctatcagtccggtttcggtaacgaattcgctagcgaggcg
gtagcgggggcgttgccggtcgggcagaactcgccgcagcgcgtggcccacgggttgtat
gccgaacagttgtcggggactgcgttcaccgcaccgcgcgcgaccaaccgacgtagctgg
ctgtaccggatccggccggcgttgttgcatggtggattcgttgcctacacccaggcgtac
gggttccataacgcgttccaggatgggccggtgtctccggaccagttgcggtggagtccg
ttgccgttgccggaagcatcgttggatttcgtcgatggcctgtacaccatggccggcaac
ggctcggccgaggcgcagcatggggtggcggtacatctgtacgcggccaatgcgtcgatg
caggggcgcttcttctacgatgcggatgcggaattattgatcgtgccgcaactgggacgg
ctgcgcgtgtgtaccgagttgggcacgctggaggtggcgccgcaggagatcgtggtgatt
ccacgcggtgtgcggtttcgtgtcgcgctgcccgatggcccttcgcggggatatgtttgc
gaaaacttcggtgccttgctgcgcttgccggaacttgggccgatcggcgccaatggtttg
gccaacccgcgcgatttcctcaccccggtggcggcctacgaggaagacgagggcgacttc
gtcttgatcgccaagtttcaggggcatttgtggcaggcgccgattgggcactcgccgttg
gacgtggtcgcctggcacggcaactatgcgccgtacaaatacgatctgcgccgtttcaat
gcgatcggttcgatcagtttcgatcatcccgacccgagcatcttcaccgtgcttaccgcg
cccagtgacactcctggcactgccaacgtcgatcttgcgatcttcccgccacgttggttg
gtggcccagcataccttccggccgccgtggttccaccgcaatgtcgccagcgaattcatg
ggcctggtgtacggtgcttacgacgccaaggccgagggcttcgtgcctggcggtgcgtcg
ttacacaactgcatgagcgggcatggtccggatgccgccacgttcgacagggcatcgcag
gccgacctgacgcgccctgacgtgatcgccgacaccatggccttcatgttcgagacccgc
gcagtgttgcgcccgacctcgcaggcgctggaagccgcgcaccgccagcgtgactaccgg
cagtgttggcagggattacgtcggcacttccgtgcgccttga

DBGET integrated database retrieval system