KEGG   Xanthomonas albilineans: XALc_2737Help
Entry
XALc_2737         CDS       T01160                                 

Gene name
hmgA
Definition
homogentisate 1,2-dioxygenase (EC:1.13.11.5)
Orthology
K00451  
homogentisate 1,2-dioxygenase [EC:1.13.11.5]
Organism
xal  Xanthomonas albilineans
Pathway
Tyrosine metabolism
Styrene degradation
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:xal00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    XALc_2737 (hmgA)
  Xenobiotics biodegradation and metabolism
   00643 Styrene degradation
    XALc_2737 (hmgA)
Enzymes [BR:xal01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.5  homogentisate 1,2-dioxygenase
     XALc_2737 (hmgA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3245669..3246970)
Genome map
AA seq 433 aa AA seqDB search
MHFDSLRYQSGFGNEFASEAVAGALPVGQNSPQRVAHGLYAEQLSGTAFTAPRATNRRSW
LYRIRPALLHGGFVAYTQAYGFHNAFQDGPVSPDQLRWSPLPLPEASLDFVDGLYTMAGN
GSAEAQHGVAVHLYAANASMQGRFFYDADAELLIVPQLGRLRVCTELGTLEVAPQEIVVI
PRGVRFRVALPDGPSRGYVCENFGALLRLPELGPIGANGLANPRDFLTPVAAYEEDEGDF
VLIAKFQGHLWQAPIGHSPLDVVAWHGNYAPYKYDLRRFNAIGSISFDHPDPSIFTVLTA
PSDTPGTANVDLAIFPPRWLVAQHTFRPPWFHRNVASEFMGLVYGAYDAKAEGFVPGGAS
LHNCMSGHGPDAATFDRASQADLTRPDVIADTMAFMFETRAVLRPTSQALEAAHRQRDYR
QCWQGLRRHFRAP
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgcacttcgattcccttcgctatcagtccggtttcggtaacgaattcgctagcgaggcg
gtagcgggggcgttgccggtcgggcagaactcgccgcagcgcgtggcccacgggttgtat
gccgaacagttgtcggggactgcgttcaccgcaccgcgcgcgaccaaccgacgtagctgg
ctgtaccggatccggccggcgttgttgcatggtggattcgttgcctacacccaggcgtac
gggttccataacgcgttccaggatgggccggtgtctccggaccagttgcggtggagtccg
ttgccgttgccggaagcatcgttggatttcgtcgatggcctgtacaccatggccggcaac
ggctcggccgaggcgcagcatggggtggcggtacatctgtacgcggccaatgcgtcgatg
caggggcgcttcttctacgatgcggatgcggaattattgatcgtgccgcaactgggacgg
ctgcgcgtgtgtaccgagttgggcacgctggaggtggcgccgcaggagatcgtggtgatt
ccacgcggtgtgcggtttcgtgtcgcgctgcccgatggcccttcgcggggatatgtttgc
gaaaacttcggtgccttgctgcgcttgccggaacttgggccgatcggcgccaatggtttg
gccaacccgcgcgatttcctcaccccggtggcggcctacgaggaagacgagggcgacttc
gtcttgatcgccaagtttcaggggcatttgtggcaggcgccgattgggcactcgccgttg
gacgtggtcgcctggcacggcaactatgcgccgtacaaatacgatctgcgccgtttcaat
gcgatcggttcgatcagtttcgatcatcccgacccgagcatcttcaccgtgcttaccgcg
cccagtgacactcctggcactgccaacgtcgatcttgcgatcttcccgccacgttggttg
gtggcccagcataccttccggccgccgtggttccaccgcaatgtcgccagcgaattcatg
ggcctggtgtacggtgcttacgacgccaaggccgagggcttcgtgcctggcggtgcgtcg
ttacacaactgcatgagcgggcatggtccggatgccgccacgttcgacagggcatcgcag
gccgacctgacgcgccctgacgtgatcgccgacaccatggccttcatgttcgagacccgc
gcagtgttgcgcccgacctcgcaggcgctggaagccgcgcaccgccagcgtgactaccgg
cagtgttggcagggattacgtcggcacttccgtgcgccttga

DBGET integrated database retrieval system