KEGG   Xanthomonas albilineans: XALc_2782Help
Entry
XALc_2782         CDS       T01160                                 

Gene name
rbsK
Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
xal  Xanthomonas albilineans
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:xal00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    XALc_2782 (rbsK)
Enzymes [BR:xal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     XALc_2782 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3295164..3296123
Genome map
AA seq 319 aa AA seqDB search
MSMRSVIVVGSFNVDHVWRCESLPAPGATITGHYSTGPGGKGFNQAVAAARAGAHTSFVC
ALGDDTGGAMARALAAQDGIALVAEVSSEPTGTGGIYVDGHGHNTIVVGPGANAALRLDF
VHAERALLGSARVLLAQLESPIETIEGTLALAREAGLTTVLNAAPANAQTSIGLLNLADV
LTPNETEFAALLARHVGERVDADAVAATDGGSLHALCRKLLPDGTVVVTLGAVGAFISHP
EEHLRGDTQAYYRIGAEAAHTVDTTGAGDAFNGALAASLALVPQAAFATHVRFANHYAAR
STEAAGACASMPHITPDVG
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgtctatgcgttcggtcatcgtcgtcggttcgttcaatgttgaccatgtgtggcgctgc
gaaagcctgccggcgccgggcgcgaccatcaccgggcactacagcaccggccccggcggt
aaaggtttcaaccaggcagtcgccgcggcccgtgccggcgcgcacaccagttttgtctgc
gcactgggcgatgacaccggcggtgcaatggcacgcgcactggccgcgcaagacggtatc
gccctggtcgccgaggtcagcagcgaaccgaccggcaccggcggcatctacgtcgatgga
cacggccacaacaccatcgtcgtcggccctggcgccaacgccgcgctgcgcctggacttc
gtacacgcagagcgcgcgctactgggatcggcgcgggtgctgctggcgcagttggagtcg
cccatcgagaccatcgaaggcaccctggccctggcgcgcgaggccggtctgaccacggta
ctcaacgccgcaccggcgaatgcacaaaccagtatcggcttgctcaatttggccgacgtc
ctcacccccaacgaaaccgagttcgccgccctgctcgcgcgccacgtcggcgaacgcgtg
gacgccgacgccgtcgccgccaccgacggcggcagcttgcacgcactgtgccgcaaactg
ctgccggacggcaccgtcgtggtgacactgggtgcagtcggcgccttcatctcacacccc
gaggaacacctgcgcggcgacacccaggcctattaccgcatcggtgccgaggccgcgcat
accgtggataccaccggcgctggtgacgcattcaacggcgccctcgctgcctcgctggcg
ctggtgccgcaggccgctttcgccacccatgtgcgcttcgccaaccactacgcggcccgc
tcgaccgaggcggcgggtgcctgcgcatccatgcctcacataacgccggacgtcggctga

DBGET integrated database retrieval system