KEGG   Xanthomonas albilineans: XALC_2782Help
Entry
XALC_2782         CDS       T01160                                 

Gene name
rbsK
Definition
(GenBank) probable ribokinase protein (EC:2.7.1.15)
  KO
K00852  
ribokinase [EC:2.7.1.15]
Organism
xal  Xanthomonas albilineans
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
Position
3295164..3296123
Genome map
AA seq 319 aa AA seqDB search
MSMRSVIVVGSFNVDHVWRCESLPAPGATITGHYSTGPGGKGFNQAVAAARAGAHTSFVC
ALGDDTGGAMARALAAQDGIALVAEVSSEPTGTGGIYVDGHGHNTIVVGPGANAALRLDF
VHAERALLGSARVLLAQLESPIETIEGTLALAREAGLTTVLNAAPANAQTSIGLLNLADV
LTPNETEFAALLARHVGERVDADAVAATDGGSLHALCRKLLPDGTVVVTLGAVGAFISHP
EEHLRGDTQAYYRIGAEAAHTVDTTGAGDAFNGALAASLALVPQAAFATHVRFANHYAAR
STEAAGACASMPHITPDVG
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgtctatgcgttcggtcatcgtcgtcggttcgttcaatgttgaccatgtgtggcgctgc
gaaagcctgccggcgccgggcgcgaccatcaccgggcactacagcaccggccccggcggt
aaaggtttcaaccaggcagtcgccgcggcccgtgccggcgcgcacaccagttttgtctgc
gcactgggcgatgacaccggcggtgcaatggcacgcgcactggccgcgcaagacggtatc
gccctggtcgccgaggtcagcagcgaaccgaccggcaccggcggcatctacgtcgatgga
cacggccacaacaccatcgtcgtcggccctggcgccaacgccgcgctgcgcctggacttc
gtacacgcagagcgcgcgctactgggatcggcgcgggtgctgctggcgcagttggagtcg
cccatcgagaccatcgaaggcaccctggccctggcgcgcgaggccggtctgaccacggta
ctcaacgccgcaccggcgaatgcacaaaccagtatcggcttgctcaatttggccgacgtc
ctcacccccaacgaaaccgagttcgccgccctgctcgcgcgccacgtcggcgaacgcgtg
gacgccgacgccgtcgccgccaccgacggcggcagcttgcacgcactgtgccgcaaactg
ctgccggacggcaccgtcgtggtgacactgggtgcagtcggcgccttcatctcacacccc
gaggaacacctgcgcggcgacacccaggcctattaccgcatcggtgccgaggccgcgcat
accgtggataccaccggcgctggtgacgcattcaacggcgccctcgctgcctcgctggcg
ctggtgccgcaggccgctttcgccacccatgtgcgcttcgccaaccactacgcggcccgc
tcgaccgaggcggcgggtgcctgcgcatccatgcctcacataacgccggacgtcggctga

DBGET integrated database retrieval system