KEGG   Xanthomonas albilineans: XALC_2915Help
Entry
XALC_2915         CDS       T01160                                 

Gene name
aceF
Definition
(GenBank) probable dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
xal  Xanthomonas albilineans
Pathway
xal00010  Glycolysis / Gluconeogenesis
xal00020  Citrate cycle (TCA cycle)
xal00620  Pyruvate metabolism
xal01100  Metabolic pathways
xal01110  Biosynthesis of secondary metabolites
xal01120  Microbial metabolism in diverse environments
xal01130  Biosynthesis of antibiotics
xal01200  Carbon metabolism
Module
xal_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:xal00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XALC_2915 (aceF)
   00020 Citrate cycle (TCA cycle)
    XALC_2915 (aceF)
   00620 Pyruvate metabolism
    XALC_2915 (aceF)
Enzymes [BR:xal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     XALC_2915 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H Biotin_lipoyl_2 HlyD_D23 RnfC_N HlyD_3 NQRA
Motif
Other DBs
NCBI-ProteinID: CBA17392
UniProt: D2UG81
Position
complement(3450814..3452526)
Genome map
AA seq 570 aa AA seqDB search
MAEIKEARVPDIGDYSDVPVIEVLVAVGDTVKKDQSLVTLESDKATMEVPSPFAGVVKEV
KVKVGDSLSEGKLVALIEVAAAGASSAPAAPAAAKAPPAPAKQDVAPAAPIKQETATPAP
AAAGGVVEARVPDIGDYSDVPVIEVLVAVGDTVKKDQSLVTLESDKATMEVPSPFAGVVK
ELKVKVGDSLSQGKVVALIEVAAAAAPGAGAVQPSAQAAGGATVPAAGSQARREDAQAPV
RAAAPAATQSSPPVEFNADSVLPQKVPYASPAVRVFARELGVDLSLVSGSEQGGRISKDD
VQRYVKAALSGAVPVGAGAAAGGNGLNLLPWPKVDFAKFGEVEVKPLSRIKKISGANLAR
NWAMIPHVTQFEQADITDLEALRVLLNKENEKAGIKLTMLAFLLKASAAALRQFPDFNAS
LDASGENLTLKKYVHIGFAADTPNGLVVPVIRDVDKKGVVELARESGELAKKARDGKLGP
AEMSGGCFSISSLGGIGGTAFTPIVNAPEVAILGVSKSSIQPVWNGKEFAPKLLLPLSLS
YDHRVIDGAAAARFTTYLSQVLADMRRVLL
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atggccgaaatcaaggaagcacgtgtccccgatatcggtgactacagcgacgtcccggta
atcgaagtgctggtggcggtcggcgacacggtgaaaaaggatcagagcctggtcaccctg
gagtcggacaaggcaaccatggaagtgccctcgccgtttgctggcgtggtcaaagaggtc
aaggtcaaggtgggcgacagtctgtccgagggcaagctcgtggcgctgatcgaggtggcc
gcagcgggcgcttccagcgcgcctgcggccccggccgccgccaaggcgccgcccgcgccg
gccaagcaggacgtcgccccggctgctcccatcaagcaggagacggccacgccagcaccg
gccgcagcgggcggggtggtcgaggcgcgggtgccggacatcggcgactacagcgatgtg
ccggtgatcgaggtgctggtggccgtcggtgacacggtgaagaaggaccagagtctggtc
accctggagtcggacaaggcgacgatggaagtgccctcgccgttcgccggtgtcgtcaag
gagcttaaggtcaaggtgggcgacagcctgtctcaaggcaaggtggtggcgctgatcgaa
gtggccgccgccgctgcgccgggcgctggcgcggtgcagcccagcgctcaagctgctggc
ggtgcgacggtgccggcagcgggctcgcaggctcggcgggaggacgcgcaggctccggtc
agggccgctgcgccggccgcgacgcagagcagcccaccagtggaattcaatgccgacagc
gtgctgccgcaaaaagtgccctatgccagtccggcggtgcgggtgttcgcgcgtgagctg
ggagtggatctgtccctggtcagtggttccgagcagggcggccgcatcagcaaggacgat
gtgcagcgctacgtcaaggcggcgctgtccggcgctgtcccggtcggtgccggggcggcg
gccggcggcaacggcctgaacctgctgccgtggccgaaggtggacttcgccaaattcggc
gaagtcgaggtcaagccgttgtcgcggatcaagaagatctctggtgccaatcttgcgcgc
aactgggcgatgattccgcacgtgacccagttcgagcaggccgacatcaccgatctggaa
gcgctgcgcgtgttgctgaacaaggagaacgagaaggctggcatcaagttgaccatgctc
gccttcctgctcaaggccagtgctgcggcgctgagacagttccctgatttcaacgcttcg
ctggacgccagtggagagaacctgaccctgaaaaaatacgtccacatcggttttgccgcc
gataccccgaacggattggtggtgccggtgatccgcgacgtggacaagaagggcgtggtc
gaattggcacgcgagagcggcgagctggccaagaaggcccgcgatggcaagctcggcccg
gccgagatgagcggcggctgtttctcgatcagctcgctcggtggcattggcggcaccgcg
ttcactccgatcgtcaatgcgccggaagtggcgatcctgggcgtgtccaaatcgtcgatt
caaccggtctggaacggcaaggaattcgcgccgaaattgctgctgccgctgtcgctgagc
tacgaccaccgggtcatcgacggtgccgcggccgcacgcttcaccacgtatctgagccag
gtgctggcggacatgcgtcgcgtgctgctgtaa

DBGET integrated database retrieval system