KEGG   Xanthomonas albilineans: XALC_2967Help
Entry
XALC_2967         CDS       T01160                                 

Definition
(GenBank) putative extracellular endoglucanase precursor protein (EC:3.2.1.4)
  KO
K01179  
endoglucanase [EC:3.2.1.4]
Organism
xal  Xanthomonas albilineans
Pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xal00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    XALC_2967
Enzymes [BR:xal01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     XALC_2967
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3504044..3505495
Genome map
AA seq 483 aa AA seqDB search
MSRSMRPRITRCLLAAALMLASSSASSYTIKGGQVMDDSGKPVQLRGVAWFGFETPLHTT
HGLWVRNWKDMITQMQSLGFNAVRLPFCPQSLQAVSPGSIDYRLNPDLQGMNSLQLMDTI
IKELSSRGMYILLDQHSPDCNTITELWYTDSYSEQQWLADLTFVAKRYANVPGVIGLDLK
NEPHGAATWGTGNTSTDWNSAAERASAVVLNAAPRWLIIVEGIYTNPSCSSNTAAHFWGE
DLEPLACTPLKIPADHLLLTPHIYGPDGYMQSYFNDPNFPNNMKAIWEQHFGQFVQAGYA
LVPGEFGGNYGQGKTKEKDVAWQNALVDYLTSKNIHGGFYWALNPNSDNIGGILNDDWTT
VRTDKVAMLHKLWGTDGGGGGGGGGGGGGGGNGNSNGNGSGNFSTHVIVDSDWHAGYCER
VQVTNTGNTAGNWELTMPISGKVNNLWNGNWNQPDTNLNVKGVDWNKTLPPSATAEFGFC
AVR
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgagtaggtcaatgagaccccgtattacccgctgtctgttggcagcggcgttaatgctg
gcaagcagttcggcatcgagctacaccatcaagggcggccaggtcatggacgacagcggc
aagcccgtgcaactacgcggcgtcgcctggttcggtttcgaaaccccgctacacaccacg
catggtctgtgggtgcgcaactggaaggacatgatcacgcagatgcaaagcctgggcttc
aatgccgtgcgcctgccattctgcccgcaaagcctgcaggctgtgtcgcccggcagcatc
gactacaggcttaacccagacctgcaagggatgaattcattgcagttgatggacacgatc
atcaaggaactcagcagccgcggcatgtacatcctgctcgatcagcactcgcccgattgc
aatacgatcaccgaactgtggtacaccgactcctacagcgaacagcaatggctggccgat
ttgaccttcgtcgccaagcgttatgccaatgttccaggcgtgatcggtcttgacctgaag
aacgagccgcacggcgcagcgacctggggcaccggcaacacctccaccgactggaactcg
gctgcagagcgcgcctccgcggtcgttctgaacgccgcgccgagatggctgatcattgtc
gaaggtatctacacgaatccgagttgctccagcaacaccgccgcccacttctggggcgaa
gacctggaaccgctggcctgcaccccgctcaaaatcccggccgatcacctgctgctgacc
ccgcatatatacggcccggacgggtacatgcaatcctacttcaacgaccccaacttcccg
aacaacatgaaagccatttgggagcagcacttcggccagttcgtgcaagccggttatgcg
ctggtgccgggcgagttcggcggcaattacggccagggcaaaacgaaggaaaaggacgtg
gcctggcagaacgcgctagtcgattacctgaccagcaagaacatccacggcggcttctac
tgggcgctcaatccgaatagtgacaacatcggcggcatcctcaacgacgactggaccacg
gtgcgcaccgacaaggtggcgatgttgcataagctgtggggcaccgacggtggtggtggt
ggtggtggtggtggtggtggtggtggtggtggcaatggcaatagcaatggcaatggcagt
ggcaacttcagcactcatgtcatcgtcgacagcgattggcatgccggctattgcgagcgc
gtgcaggtgaccaacaccggtaacaccgcaggcaactgggaactgaccatgccgatcagc
ggcaaggtcaacaatctgtggaatggcaattggaaccaacccgacaccaacctaaacgtg
aagggcgtggattggaacaagaccctgccccctagtgccacggccgagttcggcttctgt
gccgtgcgctga

DBGET integrated database retrieval system