KEGG   Xanthomonas albilineans: XALc_3028Help
Entry
XALc_3028         CDS       T01160                                 

Gene name
pcaB
Definition
3-carboxy-cis,cis-muconate cycloisomerase (EC:5.5.1.2)
Orthology
K01857  
3-carboxy-cis,cis-muconate cycloisomerase [EC:5.5.1.2]
Organism
xal  Xanthomonas albilineans
Pathway
Benzoate degradation
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:xal00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    XALc_3028 (pcaB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    XALc_3028 (pcaB)
Enzymes [BR:xal01000]
 5. Isomerases
  5.5  Intramolecular lyases
   5.5.1  Intramolecular lyases (only sub-subclass identified to date)
    5.5.1.2  3-carboxy-cis,cis-muconate cycloisomerase
     XALc_3028 (pcaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3580337..3581689)
Genome map
AA seq 450 aa AA seqDB search
MSVSDSLLRPLFGDPAVDALFDDRARLQAMLDVEAALARAQARCGVIPTSAVAPIAAACE
AAHYDLDSLAAATALAGNPAIPLVKALTAQVAATDAEAARWVHWGATSQDIIDSGAVLQL
RAALDRVEAQLEALCTALAALAQRERDTGLPGRTLLQHAVPVTFGLKAAGWLDALQRSRR
RLHALRDDALVLQFGGAAGTLAALQQCGLQVADALAQELRLPLPALPWHAARDRVGEIGA
AFALLAGSLGKIGRDVALLMQSEVAEAFEPAAAGKGGSSAMPHKRNPVGCVVAIAAATRV
PGLLSTLFAALPQEHERAVGGWHAEWETLPEIVRLSAGSLAQIRVLTEGLQLDRARMAAH
LDSHGGLLYAEAVAVNLAGQLGKAAAHALVERAVHRALETQRHLRTVLAEDAQVVAVLSP
TQLDALFGDDSWRGMAAVWIERVLAAQAPG
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtttccgattcgctattgcgtccgttgttcggcgaccccgccgtcgatgcgttg
ttcgacgaccgcgcccgtctgcaagccatgctcgatgtcgaggcggcgctggcgcgtgcg
caggcgcgttgcggggtgattccgacaagcgccgtggcgcccatcgccgccgcgtgcgag
gccgcgcactacgacctggacagcctcgccgccgccaccgcgctggccggcaatccggcc
atcccgttggtcaaggcgctcaccgcgcaagtggccgccaccgacgccgaggccgcacgc
tgggtgcattggggcgcgaccagtcaggacatcatcgacagcggcgcggttctgcaactg
cgcgccgcgctggaccgtgtggaagcgcaactggaggccttgtgcaccgcgctggcagcg
ctagcgcaacgcgagcgcgacaccggcctacccggacgcaccttgttgcaacacgccgtg
ccggtcacgttcgggctgaaagcggccggttggctggacgcactgcaacgcagccgtcgt
cgcctgcacgcattgcgcgacgatgcgctggtgctgcaattcggcggcgccgccggcacc
ctggcggcgttgcagcagtgtgggttgcaggtggccgatgctttggcccaggagctgcgt
ttgccgctgcccgcattgccgtggcatgcggcgcgcgatcgtgtcggcgagattggcgcg
gcgttcgcgctgctggccggtagcctgggcaagatcggtcgtgacgttgccttgctgatg
cagtcggaagtggccgaggcgttcgaacccgcggcagcgggcaagggcggttcctcggcg
atgccgcacaagcgcaacccggtcggctgtgtggtggcgattgccgctgccacacgcgtg
ccgggtctgctgtcgacactgttcgcggcgctgccgcaggaacacgagcgcgccgtcggc
ggctggcatgctgagtgggagaccctgccggagatcgtgcgcttgagtgccggtagcctg
gcccagatacgcgtgttgaccgaaggtctgcaactggaccgtgcacgtatggccgcgcat
ttggacagccatggcggcctgctctatgccgaagcggtcgcggtgaatctggccgggcag
ttgggtaaggccgccgcgcatgccctggtggagagggcggtccaccgcgcgctggagacg
cagcggcatctgcgcacggtgttggccgaggacgcgcaggtcgttgccgtgttgtcgccg
acgcaactggacgcattattcggcgacgacagttggcgcggcatggcggcggtgtggatc
gagcgcgtcctcgccgcgcaggcgcctggttga

DBGET integrated database retrieval system