KEGG   Xanthomonas albilineans: XALC_3083Help
Entry
XALC_3083         CDS       T01160                                 

Definition
(GenBank) putative uroporphyrinogen-III synthase protein
  KO
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
xal  Xanthomonas albilineans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xal00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    XALC_3083
Enzymes [BR:xal01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     XALC_3083
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3642627..3643427
Genome map
AA seq 266 aa AA seqDB search
MKARIMHGMSAHASTAAVAWTLISLRPLGEHGPLRRAAARHGARLLAVSPWRLQGRTDSA
TRTALAQALAAPRVIFSSPAAVRAAAALQPLVSRADQCWLAVGTGTARALNRHGIAEVTV
PTRMDSDGLLALPQLAAVAAPVGWVTAPGGRGMIAAQLQARGTPLLRADVYERVPLPLRP
QRIAQLRTVAPGVLALSSGEALQLIVAQLPDDLLAAWRAQPLVAASPRLAALATELGFTD
IAHAAGPMPQQLAAAAAAAMTRLRPG
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggctcgcataatgcatggcatgagcgcacatgcaagcaccgcagcagtagcctgg
actctgatttcactgcgcccgctcggcgagcatggaccactgcgacgggcagccgcacgc
catggcgcgcggctgctggccgtgtcgccctggcgtctgcaaggccgcaccgatagcgcc
acccgcaccgcactggcgcaggcgttggccgcaccgcgggtgatcttcagtagccccgcc
gcggtacgcgcggcggcggcgctgcagccgttggtgtccagggccgaccagtgctggctg
gcggtcggtaccggcaccgcacgcgcactaaaccgccacggcatcgccgaggtgactgtc
ccgacacggatggatagcgacggactgttggccctgccgcaactggcggctgtcgcagcg
ccggtaggatgggtcaccgcacccggtggccgcggcatgatcgccgcgcaactgcaggcg
cgcggcactccactgctgcgcgccgacgtgtatgaacgcgtaccgctgccactcaggccg
caacggatcgcgcaactgcgcaccgtcgcgcccggcgtactggcattgagcagtggcgag
gcactgcaattgatcgtggcgcaactgcccgacgacctgcttgcggcctggcgcgcacaa
ccgctggtcgcggccagcccgcgtttggcagcactggccaccgagctgggctttaccgac
atcgctcacgcggccgggccgatgccgcagcaattggcagcggccgctgcggccgcgatg
acacgtttacgacctggctga

DBGET integrated database retrieval system