KEGG   Xanthomonas albilineans: XALc_3121Help
Entry
XALc_3121         CDS       T01160                                 

Definition
aldose 1-epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
xal  Xanthomonas albilineans
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:xal00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3699060..3699926)
Genome map
AA seq 288 aa AA seqDB search
MSDVLGLSVADFHGYPSLLVDTAQSIAAISLFGGQVLSFVPKGGTDVLWLSPSAQPTPTP
IRGGTPVCWPYFGRQGQTDAVPAHGVVRTVQWQWQEAQREADGSLVLTLVPLDVDALSLR
LRLHLRIGATLEQRLITDNIGTAPARITQALHNYFRVADATQVRVQGLDGLDYLDKFDGY
ATVHRQQGDWTLQDPRDPGRSDRIYIDAGGRYTLLDPGLQRRIHLASSGSRTLVAWNPGE
AGAHAMVDVGSHWCQFVCLEPANAGPEVIELAPGARHVLQQTIAVAPL
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacgtcctcggtctgagcgtagccgatttccacggctatccttcgttgctggtg
gacacggcgcagtccatcgctgcgatcagcctgtttggcgggcaggttctgtcgttcgtg
cccaagggcggcaccgacgtcctgtggttgtcgccgagtgcgcagccgacgccgaccccg
atccgcggtggcacgccggtgtgctggccgtatttcggtcgccaaggtcagaccgacgcc
gtacccgcgcacggtgtcgtgcgcacggtgcagtggcagtggcaggaggcgcagcgagag
gccgacggtagcctggtcttgaccttggtaccgctagacgtcgacgcgctgtcattgcgc
ttgcgcctgcatctgcggatcggcgccacgttggagcagcgcctgatcaccgacaacatc
ggcacggctccggcacgcatcacccaagccctgcacaattattttcgggttgccgacgcc
acccaggtgcgggtgcagggcctggacgggctcgattacctggacaagttcgacggctac
gccacggtgcatcgtcagcagggcgattggaccttgcaggatccgcgcgatccaggccgt
agcgaccgcatctacatcgatgccggcggccgctacaccctgctcgatccgggcctgcag
cgtcggattcatctcgctagcagcggcagccgcaccctggtggcgtggaatccgggcgaa
gccggggcccacgcgatggtcgacgtgggatcccactggtgccagttcgtgtgcctggag
ccggccaacgccggaccggaggtgatcgaactggcaccgggcgcccgccacgtgctgcag
cagacaatcgcggtcgcgccactctga

DBGET integrated database retrieval system