KEGG   Xanthomonas axonopodis Xac29-1: XAC29_00805Help
Entry
XAC29_00805       CDS       T02500                                 

Definition
glycogen branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
xao  Xanthomonas axonopodis Xac29-1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xao00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    XAC29_00805
Enzymes [BR:xao01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     XAC29_00805
Exosome [BR:xao04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   XAC29_00805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
193525..195708
Genome map
AA seq 727 aa AA seqDB search
MTAVSNRWDSGVVRALAEARHGDAFAVLGAHPSDKGRLLRTYLPGADRVGAVLDDGQVVA
LDAGPEPGLFAGELPAHGGYRLRIGWPGGEQETADPYAFGPQLSDFDLHLISEGHHLQLA
DALGANVVEVEGVRGTRFAVWAPNASRVAVVGDFNSWDARRHPMRLRHQSGVWELFVPDV
GPGAHYKYQLRGPHGHELPAKADPVARRAELAPGTASIVADPTPHQWSDDGWMATRARRQ
AHDAPMSIYEIHAGSWLREAGVDLDWDGLADRLIPYVADMGFTHVELMPVSEHPFGGSWG
YQPLGLFAPTARFGTPDGFARFVDRCHREGIGVIVDWVPAHFPTDAHGLAHFDGTALYEH
ADPREGFHRDWNTLIYNHGRREVSGFLIASAMEFLQRYHVDGLRVDAVASMLYRDYSRNA
GEWIPNIHGGRENYETIAFLRRLNEVVREHTPGAVMIAEESTAFPGVTAEVAHGGLGFHY
KWNMGWMHDTLHYAGLDPIYRRYHHGELTFSMVYAYSERFVLPISHDEVVHGKGSLLGRM
PGDDWQRFANLRAYLGFMFTHPGRKLLFMGCEFGQPTEWNHDAGLPWHLLDDPRHRGVQT
LVRDLNRLYVQYPALHAHDDDPSGFAWVVGDDAGNSVVAFLRKGKRGDAPVLVVINFTPV
VQHAYRIGVPQGGQWREVFNSDAGIYGGSNLGNGGSVTAEQQSMHGHAQSLPLLLPPLGA
IVLTPYG
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgacagcagtgagcaatcgatgggattccggcgtggtacgcgccctggcagaggcgcgc
cacggcgacgcgtttgcggtcttgggtgcgcacccgtccgacaaggggcgcttgttgcgc
acctatctacccggcgccgaccgcgtcggtgcggtgctcgacgatgggcaggtggtggcg
ctggacgccggcccggagccgggcctgtttgccggcgagttgccggcgcacggcgggtat
cgcctgcgcatcggctggcccggtggcgagcaggagaccgcagacccgtatgcgttcggc
ccgcagctcagcgacttcgacctgcacctgatcagcgaaggccaccatctgcagctggcc
gacgcgctgggcgccaacgtggtcgaggtggagggcgtacgcggcacgcgctttgccgtc
tgggcaccgaatgcctcgcgcgtggcggtggtgggcgacttcaacagctgggacgcgcgc
cgtcatccgatgcggctgcggcatcagtccggcgtgtgggaattgttcgtgcccgacgtc
ggccccggcgcgcattacaagtaccagctgcgtggtccgcacgggcacgagttgccggcc
aaggccgacccggtggcgcgccgcgcggagcttgcgccgggcactgcgtccatcgtggcc
gatcccacgccgcatcagtggagcgacgacggctggatggccacgcgtgcgcgtcgccag
gcccacgacgcgccgatgagcatctacgagatccacgccggctcgtggctccgcgaagca
ggggttgacctggattgggatgggctggccgaccgcctgatcccgtacgtggccgacatg
ggcttcacccatgtcgagttgatgccggtgagcgagcatccgttcggcggctcatggggt
tatcaaccattgggtctgttcgcgcccactgcgcgcttcggcacgcccgatggatttgcg
cgctttgtcgaccgctgccatcgcgaaggcatcggcgtgatcgtcgactgggtgccggcg
cactttcccaccgatgcgcacgggctggcgcatttcgacggcaccgcgctgtacgagcat
gccgacccgcgcgaaggcttccaccgcgactggaatacgctgatctacaaccacggccgc
cgcgaggtgtccgggttcctgatcgccagtgcgatggaatttctgcagcgctatcacgtg
gacggccttcgcgtggatgcggtggcctcgatgctgtaccgcgattacagccgcaacgcc
ggcgagtggatacccaacatccacggcgggcgcgagaactacgagaccatcgcattcctg
cgccggctcaacgaggtggtgcgcgagcacaccccgggcgcggtaatgattgccgaagaa
tccactgcgtttcccggtgtcaccgccgaggtggcgcacggcggcctgggctttcactac
aagtggaacatgggctggatgcacgacaccctgcattacgccgggttggacccgatctat
cgccgctaccatcatggcgagctgactttcagcatggtctatgcgtattcggagcgcttc
gtgctgccgatctcgcacgacgaagtggtgcacggcaagggttcgttgctgggccgcatg
ccgggcgacgattggcaacgcttcgccaacctgcgcgcgtacttgggtttcatgttcacc
cacccgggacgcaagttgctgttcatgggctgcgaattcggccagccgaccgagtggaat
cacgacgccggcctgccgtggcatttgctcgacgaccctcgccatcgtggggtgcagacg
ctggtgcgcgatttgaaccggctgtatgtccaatacccggcgctccacgcacacgacgac
gatccgtccgggtttgcctgggtggtgggcgacgatgccggcaacagcgtggtggcgttc
ctgcgcaagggcaaacgcggcgacgcaccggtgctggtggtgatcaacttcaccccggtc
gtgcaacacgcatatcgcatcggtgtgccacaaggcggccagtggcgcgaggtgttcaat
agcgacgccggcatctacggcggcagcaacctgggcaatggcggcagcgtcaccgccgag
cagcaatccatgcatgggcacgcgcaatcgctgccgctgctgttgccaccgctgggcgcc
atcgtgctgacgccgtatggctga

DBGET integrated database retrieval system