KEGG   Xanthomonas axonopodis Xac29-1: XAC29_00920Help
Entry
XAC29_00920       CDS       T02500                                 

Definition
fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
xao  Xanthomonas axonopodis Xac29-1
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:xao01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:xao01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
222867..223997
Genome map
AA seq 376 aa AA seqDB search
MLSDPIIDVLTSGVAGLGVWGMLAVLLVFTQLTIFAVTLYLHRSQAHRGVDFHPVIAHFF
RFWTWLTTSMITREWVAIHRKHHAKVETEEDPHSPQTKGIAQVFWRGVELYREARTQRAD
IEQYGKGAPSDWIERHLYTPHANAGPIALLVINAVLFGLPGIALWAIQMAWIPFWAAGVV
NGLGHWWGYRNFESADTSTNLTPWALWIGGEELHNNHHAFPSSARFSMRRWELDIGWVAI
RGLQALGLAKVLRVAPSLDIRPNIAVPDADTLKALLSHRFQAMTDYQRNVFKPALREEAA
ATGAKLRELLPRRLRKGLVDDGRWLKPDARAQLQAWVAQRPRMRTLVEYPCAADRAAGSA
QPRCVRTASAIAAVVP
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgttgtccgatccgatcatcgacgttctgacctccggcgtggcagggctgggcgtgtgg
ggcatgctggcggtgctgctggtcttcacccagctcaccatctttgcagtgaccttgtac
ctgcatcgcagccaggcgcatcgcggtgtggatttccatccggtcatcgcgcatttcttt
cgcttctggacctggttgaccacctcgatgatcacccgcgaatgggtggcgatccatcgc
aagcatcacgccaaggtcgagaccgaggaagacccgcatagtccgcagaccaagggcatc
gcgcaggtgttctggcgcggcgtggagttgtaccgcgaggcacggacgcagcgcgccgat
atcgagcagtacggcaagggcgcgcctagcgactggatcgagcggcatctgtacacgccg
catgccaatgccggcccgattgcgttgctggtcatcaatgccgtgttgttcggattgccg
gggattgcgttgtgggcgatccagatggcgtggattccgttctgggctgccggtgtggtc
aatggcctgggccactggtggggctatcgcaatttcgagtcggccgacacctccaccaac
ctcacgccgtgggcgctgtggatcggcggcgaagaactgcataacaaccatcatgccttc
ccgagctctgcacggttttcgatgcggcggtgggagctggatatcggttgggtcgcgatt
cgcggcttgcaggcgctgggccttgcgaaggtattgcgggtggcgccgtcgctggatatc
cgccccaatatcgccgtgcccgatgccgacacgctcaaggcgctgctctcgcaccggttc
caggccatgaccgactaccagcgcaatgtgttcaagccggcgttgcgcgaagaggcggcc
gccaccggcgccaagctgcgcgagttgctgccgcgtcgcctgcgcaagggcctggtcgat
gacgggcgctggctcaagccggacgcgcgtgcacagttgcaggcatgggtggcgcagcgt
ccgcgcatgcgcacgctggtggagtatccgtgcgcggctgaccgcgctgctggaagcgcg
cagccacgatgcgtccgaacggcttcggcaattgcagcagtggtgccatga

DBGET integrated database retrieval system