KEGG   Xanthomonas axonopodis Xac29-1: XAC29_01320Help
Entry
XAC29_01320       CDS       T02500                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
xao  Xanthomonas axonopodis Xac29-1
Pathway
xao00630  Glyoxylate and dicarboxylate metabolism
xao01100  Metabolic pathways
xao01110  Biosynthesis of secondary metabolites
xao01120  Microbial metabolism in diverse environments
xao01200  Carbon metabolism
Module
xao_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:xao00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    XAC29_01320
Enzymes [BR:xao01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     XAC29_01320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: AGH75798
UniProt: M4TNU9
Position
307668..308963
Genome map
AA seq 431 aa AA seqDB search
MSTTLQSAEQLQQDWSNNPRWAGIARNYSAADVARLRGTVHVEHSLARLGAEKLWNSLHA
TPFVNALGALTGNQAMQQIKAGLKAIYLSGWQVAADANLAGQMYPDQSLYPADSVPAVVK
RINNTLLRADQLHHAEGNDAIDFLQPIVADAEAGFGGVLNAFELMKAMIEAGAAGVHFED
QLASVKKCGHMGGKVLVPTREAIEKLNAARLAADVLGVPTVLIARTDAEAADLITSDVDA
NDQPFTTGERTVEGFFKTRNGLDQAISRGLAYAPYADLIWCETGKPDLEFARAFAQAIHA
RFPGKLLAYNCSPSFNWKKNLDDATIAKFQTELASYGYKFQFITLAGFHALNHSMFHLAH
GYARRQMSAFVELQQAEFEAAEMGFTAVKHQREVGTGYFDAVTQAIQQGQSSTTALRGST
EEEQFQSDKAA
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgagcactacactgcaaagcgccgaacaactgcagcaggactggtccaacaaccctcgc
tgggccggcatcgcccgcaattacagcgctgccgatgtggcgcgcctgcgtggcaccgtg
catgtcgagcattcgctggcacgcctgggtgcagaaaaactgtggaattccctgcatgcc
acaccgttcgtcaatgcgctgggcgcgctgaccggcaaccaggccatgcaacagatcaag
gccggcctgaaggcgatttacctgagcggttggcaggttgccgccgatgccaatctggcc
gggcagatgtatccggatcaatcgctatacccggccgattccgtgccggcggtggtcaag
cgcatcaacaataccttgctgcgcgccgaccagctccatcatgccgaaggcaacgatgcc
atcgacttcctgcagccgatcgtggccgacgccgaagccggtttcggcggcgtgctcaac
gccttcgaactgatgaaggcgatgatcgaagccggtgcggccggtgtgcacttcgaagac
cagctggcctcggtcaagaaatgcggccatatgggcggcaaggtgctggtgcccacgcgt
gaggcgatcgaaaaattgaatgccgcgcgcctggccgccgatgtgctgggcgtgccgacg
gtgctgatcgcgcgcacagacgccgaagccgccgacctgatcaccagcgatgtggatgcc
aacgatcaaccgttcaccaccggcgagcgtacggtcgaaggcttcttcaagacccgcaat
ggcctggaccaggcaatcagccgcggcttggcctatgccccgtacgccgatctgatctgg
tgcgaaacgggcaagccggacctggaatttgcgcgcgccttcgcacaggccatccatgcc
aggttccccggcaaattgctggcctacaactgctcgccgagtttcaactggaagaagaat
ctggacgacgccaccattgccaaattccagaccgaactggcgagctatggctacaagttc
cagttcatcaccctggccggtttccatgcgttgaatcacagcatgttccatctggcgcac
ggctatgcgcgccggcagatgagcgcattcgtcgaattgcagcaggccgagttcgaggcg
gcggagatgggatttaccgcagtcaagcatcagcgcgaggtgggcaccggctatttcgat
gcagtgacgcaggcgatccagcaggggcaatcgtccacgaccgcgttgcgtggctccact
gaagaagagcaattccaaagcgacaaggcggcctga

DBGET integrated database retrieval system