KEGG   Xanthomonas axonopodis Xac29-1: XAC29_02180Help
Entry
XAC29_02180       CDS       T02500                                 

Definition
glycogen branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
xao  Xanthomonas axonopodis Xac29-1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:xao00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
504271..506502
Genome map
AA seq 743 aa AA seqDB search
MSERQGGQEQRTEADGVTTEGISEMSQTLQALADGLPADAFAVLGPKLLADGRRQVRVLA
PGAEAMGLIDPRGKLLARMQASAIDGVFEGTLAVDGPYRLRIVWPDRVQEVEDPYAFAAT
LDESLLLQIAAGDGQALRRALGAQHLHCGDVPGVRFALWAPHAQRVAVVGDFNGWDVRRH
PMRQRIGGFWELFLPRVDAGARYKYAVTAADGRVLLKADPVARQTELPPATASVVPSAAT
FAWTDAAWMANRDPAAVPGPLSIYEVHAASWRRDGHNQPLDWPTLAEQLIPYVQQLGFTH
IELLPITEHPFGGSWGYQPLGLYAPTARHGSPDGFAQFVDACHRAGIGVILDWVSAHFPD
DAHGLAQFDGAALYEHADPREGMHRDWNTLIYNYGRPEVTAYLLGSALEWIEHYHLDGLR
VDAVASMLYRDYGRAEGEWVPNAHGGRENLEAVAFLRQLNRDIATQFPGVLTIAEESTAW
PGVTAAISDGGLGFTHKWNMGWMHDTLGYMQRDPAERAHHHSQLTFGLVYAFDERFVLPL
SHDEVVHGTGGLLGQMPGDDWRRFANLRAYLALMWAHPGDKLLFMGAEFGQWADWNHDQS
LDWHLLDGARHRGMQQLVGDLNAALRRTPALYRGTHRAEGFDWSVADDARNSVLAFVRHD
PDGGAPLLAVSNLTPQPHHDYHVGVPRAGLWREILNTDSAHYGGSNLGNSGRLATEPVGM
HGHAQRLRLTLPPLATIYLQAEK
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaacggcagggcgggcaggagcagcgcacggaagcggacggcgtgaccacggaa
gggatctcggaaatgtcgcagaccctgcaagccctggccgacggcttgccggccgatgcc
tttgcggtgcttggaccgaagctgctggccgatggccgccgtcaggtgcgcgtgttggcc
ccgggtgccgaggcgatgggcttgatcgacccccgcggcaagctgctcgcgcgcatgcag
gccagcgccatcgatggcgtcttcgaaggcactctggcggtcgatgggccgtaccggctg
cgtatcgtgtggccagaccgggtgcaggaggtcgaagacccgtacgcgtttgcggccacg
ctggacgaatcgctgttgctgcagatcgctgcaggcgacggccaggcgttgcgccgtgcg
ctgggcgcgcagcatctccactgtggcgacgtgccgggcgtgcgcttcgcgctgtgggca
ccccatgcccagcgcgtggcggtggtcggcgacttcaacggatgggacgtgcggcggcat
ccgatgcggcagcgcatcggtggcttctgggaactcttcctcccgcgcgtggacgctggc
gcccggtacaagtatgccgtcaccgcagccgatgggcgggtgctgctcaaggccgacccg
gtggcgcggcagaccgaattgccgccggcaaccgcatcggtggtgcccagcgccgccaca
ttcgcctggaccgacgcggcctggatggccaaccgcgaccccgccgccgtgccggggccg
ctgtcgatctacgaggtgcatgccgcgtcctggcgtcgcgacggacacaaccagccgctg
gactggccaaccctggccgagcagttgattccctatgtgcagcagctcggcttcacccat
atcgaattgctgccgatcaccgaacacccgtttggcggttcctggggctatcagccgctg
ggcctgtatgcgcccaccgcgcgccatggcagcccggacggctttgcgcagttcgtcgac
gcctgccatcgcgccggtatcggcgtgatcctggattgggtcagtgcgcactttcccgat
gacgcgcacgggctggcccagttcgacggcgccgcgctgtatgagcatgccgacccgcgc
gaaggcatgcatcgcgactggaatacgctgatctacaactacggccggccggaagtgacc
gcttacctgctgggcagcgcgctggaatggatcgagcattaccacctcgacggcctgcgc
gtggatgcggtggcctcgatgctgtatcgcgactacggccgtgccgaaggcgagtgggtg
cccaacgcgcatggcggccgcgagaatctggaggcggtcgcgttcctgcgccagctcaac
cgcgacatcgccacgcagttccccggcgtgctcaccatcgccgaagaatcgaccgcctgg
ccgggcgtgaccgccgcgatcagcgatggcggcctgggcttcacgcacaaatggaacatg
ggctggatgcacgacacgctgggctacatgcagcgcgatccggccgaacgtgcgcatcac
catagccagctcaccttcgggctggtgtacgcattcgacgaacgcttcgtgttgccgctc
tcccacgatgaagtggtgcacggcaccggtggcctgctcgggcagatgccgggcgacgac
tggcgccgcttcgccaacctgcgcgcctatctggccctgatgtgggcgcacccgggcgac
aaactgctgttcatgggcgccgaattcgggcaatgggccgactggaatcacgaccagtcg
ctggattggcatctgctggatggcgcgcggcatcgtggcatgcagcaactggtgggcgat
ctcaacgccgcactgcgccgcacgccggcgctgtatcgcggcacccatcgcgctgaaggc
ttcgactggagcgtggccgacgatgcgcgcaacagcgtgctggcgttcgtccgccacgat
cctgacggtggcgcaccgttgctggcagtgagcaacctcaccccgcaaccgcaccacgac
tatcacgtgggggtgccgcgtgccggcctctggcgcgagatcctcaacaccgacagtgcc
cattacggcggcagcaacctcggcaacagcggtcgcttggcgaccgagccggtgggcatg
catgggcatgcgcaacgtctgcgcctgaccctgccgccgctggccacgatctatctgcaa
gcggagaaataa

DBGET integrated database retrieval system