KEGG   Xanthomonas axonopodis Xac29-1: XAC29_04170Help
Entry
XAC29_04170       CDS       T02500                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
xao  Xanthomonas axonopodis Xac29-1
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:xao00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    XAC29_04170
Enzymes [BR:xao01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     XAC29_04170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(981870..982820)
Genome map
AA seq 316 aa AA seqDB search
MSSVVVVGSFNVDHVWRCDALPVPGATIAGRYSTGPGGKGFNQAVAAARAGARTHFLCAL
GDDAGGALARSLAAHDGFALIAEPSNEPTGTGGIYVDGHGRNTIVIGAGANAVLSPAFIE
NQRPLVAAAKVLLAQLESPAETVESALALAHECGVLTVLNAAPANAPTSIGLLKLSDVLT
PNETEFAALLGRHVGERINADDVAALDGNTLHSLCRKLLPGGTVVVTLGAVGAFISHAEE
QLRGDTQAHYRVGAESAQTIDTTGAGDAFNGALVASLAQLPAASFATHVRFATRYAARST
EVEGAAVSMPRLRADD
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgagttcggtcgtcgttgtcgggtccttcaatgtcgatcacgtgtggcgctgcgatgcc
ttgccggtgccgggtgcgaccatcgccgggcgctacagcaccggcccgggcggcaagggc
ttcaatcaggcggttgcggccgcacgtgctggcgccaggacgcatttcttgtgcgcgctg
ggcgacgatgccggtggtgcgttggcgcgctcgctggccgcgcacgatggctttgcgctg
atcgccgagcccagcaatgaaccgaccggcactggcggcatctacgtcgacgggcatggc
cgcaacaccatcgtgatcggcgccggcgccaacgccgtgttgagcccggccttcatcgag
aaccagcgcccgctggtggctgcagcaaaagtgctgctggcgcagctggaatctccggcc
gagacggtcgagtctgcactggcgctggcgcacgaatgcggcgtgctgacggtactcaat
gccgccccggccaatgcgccgacatcgatcggcctgctcaagctctcggatgtgctgacg
cccaacgaaaccgaattcgccgcgctgctcggtcgccatgtcggcgagcgcatcaatgcc
gacgacgtcgccgcgctggacggcaatacgctgcattcgctgtgccgcaagctgctgccg
ggcggtaccgtggtggtgacgctgggcgcggtgggcgccttcatttcgcacgccgaagaa
caactgcgcggcgatacccaggcgcattaccgggtgggcgcggaaagcgcgcagaccatc
gacaccaccggtgccggcgacgccttcaacggtgcgctggttgcctcgctggcgcagctg
ccggctgccagcttcgcaacccacgtgcgcttcgccacccgttacgcggcgcgctccacc
gaggtggaaggtgcggcggtgtcgatgccgcggctgcgcgcggacgactga

DBGET integrated database retrieval system