KEGG   Xanthomonas axonopodis Xac29-1: XAC29_05905Help
Entry
XAC29_05905       CDS       T02500                                 

Definition
O-glycosyl hydrolase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
xao  Xanthomonas axonopodis Xac29-1
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:xao00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:xao00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1340977..1342353
Genome map
AA seq 458 aa AA seqDB search
MSSTGALRVYTSSQGATQQMRVSTAAAPANGHPLTEKENSIFVNPQRQFQELLGIGGAIT
DSSAETFAKLPKRAQRALLTAYYDPQQGIGYTLARTTIHSSDFSSGSYTYIKEGDAALKS
FSVKHDAKYRIPMLRQAIAAAGGKLTTFASPWSAPAFMKDSNNMLKGGKLLPEYAQAWAS
YYTRFIAAYEKAGIPIWGISLQNEPMAVQTWESMLFSAEEERDFLKHHLGPTMASAGYGE
RKIIVWDHNRDMMVHRAHVIFDDPEAAKYAWGMGFHWYETWAGFEPMVENVAAVAQAYPD
KHLLLTEAAVEKFDPAKLQYWPNGERYGTAIINDLNHGAVGWTDWNILLDQHGGPNHVGN
YCFAPVHADTRTGEVIYTPSYWYIGHFSKFIRPGARRVSSASSRSNLATTAFLNTDGSLA
MVVMNAGDVAIAYNLYVGEASSTLEIPAHAIQTVVLAQ
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagcactggtgcactgcgcgtctacaccagttctcaaggtgccacgcagcagatg
cgcgtcagcacggctgctgctcctgccaacgggcatccgctgaccgaaaaagaaaactcc
atcttcgtcaatccgcaacggcaatttcaggaactgttgggcatcggtggcgcgatcacc
gattccagcgcagagacctttgccaagctgcccaagcgtgcgcaacgtgcgctgctcacg
gcgtactacgatccgcagcagggcattggctacacgctggcgcgtaccaccatccatagc
tcggatttcagcagcggcagctacacctacatcaaggagggcgatgcggcgctgaagagt
ttttcggtcaagcacgatgccaagtaccgcatcccgatgttgcgccaggcgattgcggcg
gccggcggcaagctcaccacgtttgccagcccatggagcgcgccggccttcatgaaagac
agcaacaacatgctcaagggcggcaagctattgcccgagtacgcgcaggcctgggcaagc
tactacacgcggtttatcgcggcatacgaaaaagcgggcatcccgatctggggcatcagc
ctgcagaacgagccgatggcggtgcagacctgggagtcgatgctgttttcggccgaggaa
gagcgcgacttcttgaagcatcatcttgggcccaccatggccagcgccggctacggcgag
cgcaagatcatcgtgtgggaccacaaccgcgacatgatggtgcaccgcgcgcatgtgatc
ttcgatgacccggaggcggcaaaatatgcatggggcatgggcttccattggtatgaaacc
tgggccggattcgagccgatggtggagaacgtggcggcagtggcgcaggcgtacccggac
aagcacttgctgttgaccgaagcggcggtggaaaagttcgacccggccaaattgcagtat
tggcccaatggcgaacgctacggcacggccatcatcaacgacctcaatcatggcgcagtg
ggctggacggactggaacattctgctcgaccagcatggtgggccgaaccacgtgggcaat
tactgctttgcgccggtgcatgccgatacgcgcacgggcgaggtgatctatacgccgagc
tattggtatatcggccacttttccaaattcatccggccgggcgcacggcgggtcagctca
gccagcagccgtagcaatctggcgaccacggcgttcctcaacaccgatggcagcctggcc
atggtggtcatgaatgccggcgacgttgcgattgcttacaacctgtatgtgggcgaggca
tccagtacgttggagattccggcgcatgcgatccagaccgtggtattggcgcagtaa

DBGET integrated database retrieval system