KEGG   Xanthomonas axonopodis Xac29-1: XAC29_08935Help
Entry
XAC29_08935       CDS       T02500                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
xao  Xanthomonas axonopodis Xac29-1
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:xao00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:xao00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2045215..2046552
Genome map
AA seq 445 aa AA seqDB search
MSNTVYIGAKEYFPGIGKIGFEGRDSDNPLAFKVYDANKTIGDKTMAEHLRFAVAYWHSF
CGNGADPFGPGTRAYPWDVGDTALNRAEAKADAAFEFFTKLGVPYYCFHDIDLSPDADDI
TEYESNLKHMVGVARQRQADTGIKLLWGTANLFSHPRYMNGASTNPDFNVVARAAVQVKA
AIDATVALGGENYVFWGGREGYACLHNTQMKREQDNMARFLTLARDYGRSIGFKGNFLIE
PKPMEPMKHQYDFDSATVIGFLRQHGLDQDFKLNIEANHATLSGHSFEHDLQVASDAGLL
GSIDANRGNAQNGWDTDQFPTDLYDTVGAMLVVLRQGGLAPGGLNFDAKVRRESSDPQDL
FLAHIGGMDAFARGLEVANALLTASPLEQWRAERYASFDSGAGADFAAGKTTLADLAKHA
AGNAPQQISGRQEAYENLINQYLTR
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacaccgtgtacatcggcgcgaaagaatatttccccggcatcggcaagatcggt
ttcgaaggccgcgattcggacaacccgctcgcgttcaaggtctacgacgccaacaagacc
atcggcgacaagaccatggccgagcatctgcgctttgccgtggcctactggcacagcttc
tgcggcaatggcgccgatccgttcggcccgggcacgcgtgcgtatccgtgggatgtgggc
gataccgcgttgaaccgtgccgaagccaaggccgatgcggcgttcgagttcttcaccaag
ctcggcgtgccgtactactgctttcacgacatcgacctgtcgccggatgccgatgacatc
actgagtacgagagcaacctcaagcacatggtgggcgttgccaggcagcgccaggccgac
accggcatcaagctgctgtggggcacggccaacctgttctcgcatccgcgctacatgaat
ggtgcctcgaccaacccggacttcaatgtcgtggcgcgtgcggcggtgcaggtcaaggcc
gcgatcgatgccacggtggcgctgggcggcgaaaactacgtgttctggggcgggcgcgaa
ggctatgcctgcctgcacaacacgcagatgaagcgcgagcaggacaacatggcgcgcttc
ctcaccctggcgcgcgactacggccgcagcatcggcttcaaaggcaacttcctgatcgag
ccgaaacccatggagccgatgaagcaccagtacgattttgatagcgccaccgtgatcggc
ttcctgcgtcagcatggcctggaccaggacttcaagctcaacatcgaggccaaccacgcc
accttgtcgggccatagcttcgagcacgacctgcaggtggcatccgatgccggcctgctc
ggcagcatcgatgccaaccgcggtaacgcgcagaacggctgggacaccgaccagttcccg
accgatctgtacgacaccgtcggcgccatgctggtggtgctgcggcagggcgggctggca
ccgggcggcttgaacttcgatgccaaggtgcgtcgcgaatcgtccgacccgcaggacctg
ttcctggcccacatcggcggcatggacgcgttcgcccgcgggctggaagtggccaacgcg
ctgctgaccgcctcgccgctggaacagtggcgcgccgagcgttacgccagcttcgacagc
ggcgcgggcgcggactttgccgcaggcaagaccacattggcggatctggccaagcatgcg
gccggcaatgcgccccagcagatcagcggccgccaggaagcgtatgaaaacctgatcaat
cagtatctgacgcgttga

DBGET integrated database retrieval system