KEGG   Xanthomonas axonopodis Xac29-1: XAC29_11875Help
Entry
XAC29_11875       CDS       T02500                                 

Definition
(GenBank) gamma-glutamyl kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
xao  Xanthomonas axonopodis Xac29-1
Pathway
xao00330  Arginine and proline metabolism
xao00332  Carbapenem biosynthesis
xao01100  Metabolic pathways
xao01130  Biosynthesis of antibiotics
xao01230  Biosynthesis of amino acids
Module
xao_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:xao00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    XAC29_11875
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    XAC29_11875
Enzymes [BR:xao01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     XAC29_11875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: AGH77832
UniProt: M4TYC6
Position
complement(2755228..2756385)
Genome map
AA seq 385 aa AA seqDB search
MSTPASTSSPFTEQALPPWRRAVLKVGSSLLAADGGGLSPRFALGLAQFVSANLAAGREL
VIVSSGAVAAGRAILPKAMDVGAPIAARQALAALGQAQLIALWQRFFERPVAQVLLTHDD
LRNRRRYLNARATLGELLRLGALPVINENDTVSVDELKLGDNDNLAAIVAALVDADALFI
ATDIDGLYSADPRSNPLARPLDDVPELTPEVLAMAGGSGSNVGTGGMRTKLEAAAKAGAA
GIETYLFNGRSGEVVRALALDRLRGTRIHAARTRIAARKYWLRHAPVEAGAILIDDGAAA
ALTGKGASLLPGGVAGAQGDFRRGDMVEIRRRDTTGDGQCLARGVSQYSALDIRRIAGRH
SREIENVLGYSYGENVVHRDDLVVL
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgcctgccagcacgtcgtcgccctttaccgagcaggcattgccgccatggcgc
cgtgcggtgctcaaggtcggcagcagcctgctcgccgccgatgggggggggctgtccccg
cgcttcgcgctcggtctggcgcagttcgtctccgccaatctggcagccgggcgcgagctg
gtgatcgtgtcgtcgggcgcggtggccgccggccgtgccatcctgcccaaagcgatggat
gtcggcgcaccgatcgcggcacggcaggcactggccgccttgggccaggcgcagttgatt
gcgttgtggcagcgctttttcgagcgaccggtggcgcaggtactgctcacgcatgacgac
ctgcgcaaccgtcgccgctacctcaatgcgcgtgccaccttgggcgagttgctgcggctg
ggcgcgctgccggtgatcaacgaaaacgataccgtctcggtggatgagttgaagctgggc
gataacgacaacctggctgcgatcgtggctgcgctggtcgatgccgacgcgttgtttatc
gccaccgatatcgatggcttgtatagcgccgacccacgcagcaacccgttggcgcgcccg
ctcgacgatgtgcccgagctcactccggaggtgctggcgatggccggcggcagcggtagc
aatgtgggtaccggaggcatgcgcaccaaactggaagccgctgcaaaggccggcgcggcc
ggcatcgaaacctatctgttcaacggccgaagtggcgaggtggtgcgcgccctggcgctg
gaccgcctgcgtggcacgcggatccacgccgcacgcacgcgcatcgctgcgcgaaaatac
tggctgcggcacgcaccggtggaagcgggcgcgatcctcatcgacgacggcgccgcagcg
gccttgaccggcaagggcgcttcgctgttgccaggcggggtggccggcgcgcagggcgat
ttccgtcgcggcgacatggtggagatccgtcggcgcgataccacgggcgacggacagtgt
ctggcacgcggcgtcagccagtattcggccctggatatccgtcgtatcgcaggccgccat
tcgcgcgagatcgagaacgtgctcggctacagttacggcgaaaacgtggtgcatcgcgat
gatttggtggtgttgtag

DBGET integrated database retrieval system