KEGG   Xanthomonas axonopodis Xac29-1: XAC29_17795Help
Entry
XAC29_17795       CDS       T02500                                 

Definition
aminotransferase AlaT (EC:2.6.1.2)
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
xao  Xanthomonas axonopodis Xac29-1
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:xao00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    XAC29_17795
   01230 Biosynthesis of amino acids
    XAC29_17795
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    XAC29_17795
   00290 Valine, leucine and isoleucine biosynthesis
    XAC29_17795
Enzymes [BR:xao01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     XAC29_17795
    2.6.1.66  valine---pyruvate transaminase
     XAC29_17795
Amino acid related enzymes [BR:xao01007]
 Aminotransferase (transaminase)
  Class I
   XAC29_17795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4139960..4141231
Genome map
AA seq 423 aa AA seqDB search
MSTAPQKPLAIRERLSEVRYEIRGELARRARELEAQGRKLIKLNIGNPGAFGFRAPEHLQ
RAIADDMGRTDPYTHQQGLPEAREAIATAYARRQHPDAHPDRIFVGNGVSELIDLSLRAL
LNPGDEVLVPSPDYPLWSAATILNDGRPVYYRCAPENGFQPDPVEIETLVSSRTRAIVLI
NPNNPSGASYSRELLERIVAIATKHNLLLMVDEIYDQVLYDDAAFVPVAPLAGAHPCITF
SGLSKVHRACGWRVGWALLSGDQARINDLRNAMDLLGALRLCANVPGQYAIDAAVNGPDT
ISALCAPGGRLYETRRAVIEACAASEHLSLVAPAGALYAFPAVVGAAARNFDDHAFALDL
MNEEGVLVVPGSSFNVPYRHHFRVTLMPEAGVMRDVFARIDRALARRAEAVTKVVPLKPR
SVA
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgtccactgccccgcaaaagccgctcgccatccgcgagcgtctgtccgaagtccgctac
gaaatccggggcgagctggcgcgacgagcgcgggagctggaggcgcagggccgcaagctg
atcaagctcaatatcggtaacccgggtgcgttcggcttccgtgcgccggagcatctgcag
cgcgccatcgccgacgacatgggccgcaccgatccgtacacccatcagcaaggcctgccg
gaagcgcgcgaggcgatcgccaccgcatatgcgcggcgccagcatccggatgcgcatccg
gaccgcatcttcgttggcaacggcgtcagcgaactgatcgatctgtcgctgcgtgcgctg
ctcaatcccggcgacgaagtgctggtgccctcgcccgactatccgctgtggtcggccgcg
accatcctcaacgatggtcgtcccgtgtattaccgctgcgccccggaaaacggcttccag
ccggacccagtggagatcgagacgctggtgtcctcgcgcacccgcgccatcgtgctgatc
aatccaaacaatcccagcggcgccagttattcgcgcgaactgctggagcgcatcgtggcg
atcgccaccaagcacaatctgctcttgatggtcgatgagatctacgaccaggtgctgtac
gacgacgcggccttcgtgccggtcgcgccgctggccggcgcgcacccgtgcatcactttc
agcggcctgagcaaggtgcatcgcgcctgcggttggcgcgtgggctgggcactgctgtcg
ggcgaccaagcgcgcatcaacgacttgcgcaatgcgatggacctgctcggcgccttgcgc
ctgtgcgccaatgtaccaggccagtacgccatcgatgcggccgtgaacgggccggacacc
atctcggcattgtgcgcacccggcggacggctgtacgaaacccgccgcgcggtgatcgag
gcctgcgcggccagcgagcatctgtcgctggtggcaccggccggtgcgctgtatgcgttc
ccggcagtggtgggcgcggcggcgcgcaacttcgacgatcatgcgttcgccctcgatctg
atgaacgaggaaggcgtgctggtggttcccggctccagcttcaacgtgccgtatcgccat
catttccgcgtgacattgatgccggaagccggtgtgatgcgcgatgtgttcgcgcgcatc
gaccgtgcactggcacgccgcgccgaagcggtcaccaaggtggttccactcaagccacgc
agcgtggcctga

DBGET integrated database retrieval system