KEGG   Xanthomonas axonopodis Xac29-1: XAC29_18075Help
Entry
XAC29_18075       CDS       T02500                                 

Definition
disulfide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
xao  Xanthomonas axonopodis Xac29-1
Brite
Enzymes [BR:xao01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     XAC29_18075
Secretion system [BR:xao02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   XAC29_18075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4217655..4218458)
Genome map
AA seq 267 aa AA seqDB search
MYRLAIAALLGAISLTACAQSSQPAASTAGAKPAAAPAATGTGTVDQRVSTALKALDPDF
KPDYIGAAPFPGFREVVVGGQVLYVSDDGRYLIQAQPFDIQNKQFAASPGLLAYRRKQLD
TVPKADRIVFAPANPKYTVTVFTDVECGYCRKLHSEIGELNKQGIAVEYLAFPRMGLGSQ
DHKEMIAVWCAADRKQALTAAKSGQPVASKDCKNPVSMEYNLGQRLGVNGTPAIFAPDGT
QLGGYLPPAQLREALEKRAVSTAGGSR
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgtatcgtcttgccatcgccgcgctgctgggcgcgatcagccttaccgcctgcgcacaa
tcctcgcagcctgcggcaagcactgccggcgccaagccagccgctgcgcccgccgccacc
ggcaccggcaccgtggaccagcgcgtgagcacggcgctcaaggcgctggacccggatttc
aaacccgattacatcggcgctgcgccgttccccggctttcgcgaagtggtcgtcggcggg
caggtgctgtacgtcagcgacgacggtcgttacctgatccaggcgcagccgttcgacatc
cagaacaagcagttcgccgccagcccgggcttgctggcctaccgccgcaagcagctggac
accgtgcccaaggccgaccgcatcgtgttcgcgccggccaacccgaagtacaccgtcacc
gtcttcaccgatgtggagtgcggttactgccgtaagttgcatagcgagatcggcgagctc
aacaagcagggcatcgcggtggaatacctggcgttcccgcgcatgggcctgggcagccag
gaccataaggaaatgattgcggtgtggtgcgctgccgatcgcaagcaggcgctcacggcc
gccaagtcgggtcagccggtcgcctccaaggactgcaagaacccggtgtcgatggaatac
aacctgggccagcgcctgggcgtcaacggaacgccggcgatcttcgcccccgacggcacc
cagctcggtggctacctgccgccagcccagttgcgtgaggcgctggaaaagcgtgccgtg
agcacggcgggcggcagccgctga

DBGET integrated database retrieval system