KEGG   Xanthomonas axonopodis Xac29-1: XAC29_20975Help
Entry
XAC29_20975       CDS       T02500                                 

Definition
alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
xao  Xanthomonas axonopodis Xac29-1
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:xao00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    XAC29_20975
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    XAC29_20975
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    XAC29_20975
Enzymes [BR:xao01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     XAC29_20975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4878399..4880027
Genome map
AA seq 542 aa AA seqDB search
MPVIDPPAASPLPDCAATLVPPDPSRRRILIAGASLAAAGLLSPFARASGSADPFTLGVA
AGDPLADGFVIWTRLAPRPLDPDGRGGLRAAVPVRWQVASDPQMRTIVRQGETIASPVWG
HAVHVELTGLMADRPYWYCFQALGARSPIGSARTLPAAHQTPDAARFGFVSCSHWELGYF
SAYRHLAAEQPDLVFFLGDYIYEYSNHGEATNKIVRPHGSGECLDLAGYRNRYALYRTDP
DLQALHAGSACAATWDDHEVQNDYANRWSQDPSIPVDTFLARRAAAYRAFYEHFPLRARH
RPHGADMRIYRSFDYGQLARFYVLDGRQYRSEQPCPQANGWRGGHVVADSCRERTDPRRT
MLGWEQERWLHGGFAQSPARWNVIAQDLLVAPMRQAGRDGVVGHWTDGWDGYPATRERML
DAIAKTRLRNPVFWGGDIHSYWVTDLKADPADDASATLATEFVGTSITSDGQSNDELHAT
MAANPHVHYVDGQTRGYVSVTLTPGRMETRLQGISDRRDRNATVSTTKRFVVEDGRPGAV
EA
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtgatcgacccgcctgccgcctcacccctgcctgattgcgctgccacgcttgtg
ccaccggatccgagccggcggcgcatcctcatcgccggcgccagcctggctgcggcgggg
ctgctgagcccgttcgcacgcgccagcggcagtgccgatcccttcacgctgggcgtggcg
gccggcgacccgttggccgatggctttgtgatctggacgcggctggcaccccgcccgctg
gacccggacggacgcggcggcctgcgcgcggcggtgccggtgcgctggcaggtggccagc
gacccgcagatgcgcaccatcgtgcgccagggcgagaccatcgccagccccgtctggggc
cacgcagtgcacgtggagctcaccggtttgatggccgatcgcccctactggtactgcttt
caggccctgggtgcacgcagcccgatcggcagcgcgcgcaccctgccggcagcgcatcag
acgccggacgcagcgcggttcgggtttgtttcctgctcgcactgggaactggggtatttc
agcgcctaccgccacctcgccgccgagcagccggacctggtgttcttcctgggcgattac
atctacgagtacagcaaccacggcgaggcgacgaacaagatcgtgcgcccgcacggcagc
ggcgaatgcctggatctggccggctaccgcaatcgctatgcgctgtaccgcaccgacccg
gacctgcaggcgctgcatgccggcagcgcctgcgcggcgacctgggacgatcacgaggta
cagaacgattacgccaatcgctggtcgcaggacccgtcgattccggtcgatacctttctg
gcccggcgcgctgccgcctaccgcgccttctacgaacatttcccgctgcgtgcgcggcat
cgcccgcacggcgcggacatgcgcatctaccgctcgttcgattacggccagctggcgcgt
ttctacgtgctcgatggccgccagtaccgcagcgagcaaccctgcccgcaggccaatggc
tggcgcggcggccatgtggtggccgacagttgccgcgagcgcaccgacccgcggcgcacc
atgctcggctgggaacaggagcgctggctgcatggcggcttcgcgcagtcgcccgcccgc
tggaacgtgattgcgcaggatctgctggtggcaccgatgcgacaggcggggcgcgacggc
gtggtcgggcactggaccgacggttgggacggctacccggccacgcgcgaacgcatgctc
gatgcgattgcaaagacgcgcctgcgcaacccggtgttctggggcggcgacatccactcg
tactgggtcaccgacctgaaggccgatccggccgacgacgcgtcggcaacgctggccacc
gaattcgtcggcacttcgatcacctccgacggccagagcaacgacgaactgcatgcgacc
atggcagccaacccgcacgtgcattacgtggacgggcaaacgcgcggctatgtgtcggtg
acgctcacgccgggccggatggaaacgcggctgcagggcatctccgatcggcgcgaccgc
aacgccacggtgtcgaccaccaagcgcttcgtggtggaggacggcaggcccggcgcagtg
gaggcgtga

DBGET integrated database retrieval system