KEGG   Xanthomonas axonopodis Xac29-1: XAC29_21405Help
Entry
XAC29_21405       CDS       T02500                                 

Definition
L-fuculose phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
xao  Xanthomonas axonopodis Xac29-1
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:xao00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    XAC29_21405
Enzymes [BR:xao01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     XAC29_21405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4987655..4988335)
Genome map
AA seq 226 aa AA seqDB search
MFAHEQRQRVVALCIELSRRGYLAGTGGNVALRIDAECFAVTPSAIDYLSMQAEDICIVR
TKDLHQLDGTRTPSVETGLHAQVMRRRPDVGCSIHTHQPVASACTLLGAPLEVTQPALRR
LLGARIPIAGYMPSGTGLLARLLARQLRPTVNAYLLRNHGVVCCGTNLQAAVTVVEALEL
VARSHLQTQIQARAAREPDLAAGLQRVLTALDSHRHTSGASSLSQT
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcccatgaacaacgccagcgcgtggtcgcgctgtgcatcgaactgtcgcgccgc
ggctatctggctggcaccggcggcaatgtcgccttgcgtatcgatgccgagtgtttcgcg
gtcaccccttcggcgatcgactacctgagcatgcaggccgaggatatctgcatcgtccgc
accaaggacctgcaccagctcgacggcacgcgtacgccgtcggtcgaaaccggcctgcat
gcgcaggtgatgcggcggcgcccggacgtgggctgcagcatccacacccaccagccggtc
gccagcgcctgcaccctgctgggcgcgccattggaggtgacgcaaccggcgttgcgccgg
ctgctcggcgcacggattccgatcgccggctacatgccgtcgggcaccggcctgctggcc
cgcctgctggcccggcagctgcggcccaccgtcaacgcctatctgctgcgcaatcacggc
gtggtctgctgcgggaccaacctgcaggcggccgtcaccgtggtcgaggcgttggagctg
gtcgcgcgcagccacctgcagacgcagatccaggcgcgtgcggcgcgcgagcccgacctc
gctgcgggcctgcagcgggtgctgacggcgctggattctcaccggcacacgtccggtgcg
tcctccctttcccagacatga

DBGET integrated database retrieval system