KEGG   Xanthomonas axonopodis Xac29-1: XAC29_21435Help
Entry
XAC29_21435       CDS       T02500                                 

Definition
endo-1,4-beta-xylanase A
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
xao  Xanthomonas axonopodis Xac29-1
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4993347..4994579)
Genome map
AA seq 410 aa AA seqDB search
MRSSASETCGLSTDLPMHINRTNLTKPLGLLIAGLSAVCTLQAFAACGTPGTSLKQAYAQ
GFLLGTAVNADIVSGKDAASAALVACHFNAVTAENVMKAEVVAPRRGVQDFSAADAFVAY
AQRDRQFVVGHTLVWHNQTPEWFFTTADGRPNTPAQQLERMRAHIAAVAGRYTGKVQAWD
VVNEIIDEDGSYRSTNWVQRVGDGDTVVRNAFAFAQRYAPDAQLYYNDFNAWRPAKREGI
VRMVKMLQQAGVRIDGVGMQGHWGLNYPSLRDIEDAIDAYAALGVKVMITELDIDVLPLT
KEGQIIGTGMAHKQFQLPEFKRFLDPYRDGLPADVQAQLRDRYAELFALFWRKRDKIARV
SVWGVSDDMSWKNDYPVPGRTNYPLLFDRNHQPKPALDAVVAVPSATAAR
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgcgatccagtgcaagcgaaacctgcggcctctcaacggacctgcccatgcacatcaac
cgcaccaacctcaccaaacccctgggcttgctgatcgccggcctgagtgcagtgtgcaca
ctgcaggccttcgccgcatgcgggacgcccggcacctcgctcaagcaggcgtatgcgcaa
gggtttttgctcgggactgccgtcaatgccgatatcgtctccggcaaggacgcagcctct
gctgcgctggtggcctgtcacttcaatgcggtcaccgcggaaaacgtgatgaaggccgaa
gtggtggcgccgcgtcgtggcgtgcaggatttcagcgcggccgatgcattcgtggcttac
gcacagcgcgatcggcagttcgtggtcggtcacaccctggtctggcacaaccagacaccg
gagtggttcttcaccaccgccgatggtcggcccaatacgccggcacagcagctggagcgc
atgcgcgcgcatatcgcagcggtggccgggcgttacacgggcaaggtgcaagcctgggat
gtggtcaacgaaatcatcgacgaagacggcagttaccgttcgaccaactgggtgcagcgc
gtgggcgacggcgacacggtggtccgcaatgccttcgccttcgcacagcgctatgcaccg
gatgcgcagctctactacaacgatttcaatgcatggcggccggccaagcgcgagggcatc
gtgcgcatggtcaagatgctgcagcaggccggtgtccgcatcgatggcgtgggcatgcag
ggccattgggggctgaactaccccagcctgcgcgatatcgaagacgcaatcgatgcgtac
gctgcgcttggcgtcaaagtgatgatcaccgagctggacatcgatgtgttgccgctcacc
aaggaaggccagatcatcggtaccggcatggcgcacaagcagtttcaactgccggaattc
aagcgttttctcgacccctatcgcgatggtttgcctgccgacgtgcaggcgcaattgcgc
gaccggtatgccgaattgttcgcgttgttctggcgcaagcgcgacaagattgcgcgcgtc
agcgtgtggggagtgagcgatgacatgtcgtggaaaaacgattacccggtgcctggacgc
accaattatccgctgctgttcgatcgcaatcatcaacccaaaccggcgttggatgcggtg
gtggcggtgccctccgcgaccgctgcacgctag

DBGET integrated database retrieval system