KEGG   Xanthomonas axonopodis Xac29-1: XAC29_21460Help
Entry
XAC29_21460       CDS       T02500                                 

Definition
xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
xao  Xanthomonas axonopodis Xac29-1
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5000367..5001326)
Genome map
AA seq 319 aa AA seqDB search
MAAGMAAPVHAAPLAATASKFLGCAYGAQQAPGFAQYWNKLTPENGGKWGSVEAVRDQMD
WSTLDAAYRFAQANQMPFQMHVMVWGNQQPEWIKTLRPAEQRREIEQWFAAVAQRYPDIA
LLEVVNEPLNDPPSKADTGGGNYLQALGGNGDSGWEWVLQSFRLARRHFPHTKLMINDYS
ITSSAQATQKYLQIVRLLQRENLVDAIGVQEHAFETTPEVAVSVHRDNLDALAATGLPIY
ITEFDLDGPTDAQQLADYKRVFPVFWEHPAVHGITLWGFRPGLWRDKEAAYLIRADGTER
PALTWLRDYVAAHPGTPAP
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggcggccggcatggccgcgcctgtacacgcggcaccactggcagcgacagcgtccaag
ttcctcggatgtgcgtacggcgcgcagcaggcgccggggtttgcgcagtactggaacaag
ctcaccccggaaaacggcggcaaatggggcagcgtggaggccgtgcgcgaccagatggat
tggagcacgctggatgccgcataccggttcgcccaggccaatcagatgccgttccagatg
catgtcatggtgtggggcaaccagcagccggaatggatcaagaccttgcggccggccgaa
cagcgccgcgagatcgagcagtggtttgccgccgttgcgcagcgctacccggatatcgca
ctgctggaggtggtgaacgagccactcaacgacccgcctagcaaggccgataccggcggc
ggcaattatctgcaggcgttggggggcaacggcgacagcggctgggaatgggtgttgcaa
tcgtttcggcttgcgcgccggcattttccgcacaccaagttgatgatcaacgactacagc
atcaccagtagcgcgcaggccacgcagaagtatttgcagatcgtgcggctgctgcagcgt
gagaacctggtcgatgccatcggcgtgcaggagcacgccttcgagaccacgccggaggtt
gcggtgtcggtgcaccgcgacaatctggatgcgttggccgccaccggcctgccgatctac
atcaccgagttcgatctggacggcccgaccgatgcgcagcagctggccgactacaagcgg
gtgtttccggtgttctgggaacacccggcagtgcatggcatcaccttgtggggctttcgg
cccggtttgtggcgcgacaaggaagctgcgtacctgatccgcgccgacggcaccgaacgt
cccgcgctcacgtggctgcgcgattacgttgctgcccatcccggtacacctgcgccatga

DBGET integrated database retrieval system