KEGG   Xanthobacter autotrophicus: Xaut_0158Help
Entry
Xaut_0158         CDS       T00581                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
xau  Xanthobacter autotrophicus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:xau00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Xaut_0158
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Xaut_0158
  Amino acid metabolism
   00310 Lysine degradation
    Xaut_0158
Enzymes [BR:xau01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Xaut_0158
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
154367..155596
Genome map
AA seq 409 aa AA seqDB search
MTTEIRVPTLGESVTEATIGKWFKKPGDTVKADEPLVELETDKVTVEVPAPAAGVLAEIV
AKDGDTVGVGALLGSIGAGSGAAAAAPAAAAPAPAAAAPAPAPAPAAAPAASGSSVNGPA
VGRIAAESGVDPSGVAGSGKDGRVTKGDMLAAVAAGAAAAPAAAPIAVRAPSAPIDAVRE
ERVKMTKLRQTIARRLKDAQNTAAMLTTFNDVDMSAVMSLRAQFKDAFEKKHGTKLGFMG
FFTKAVIAALKDLPAVNAEIDGQDLVYKNYYNIGIAVGTEKGLVVPVVRDADQLSVAEIE
KAIAGFGRKARDGKLGIEDMQGGTFTITNGGIYGSLMSTPILNAPQSGILGMHRIEERPV
AIKGQVVIRPMMYLALSYDHRIVDGREAVTFLVRVKETLEDPARLVLDL
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccgagatccgcgtaccgaccctgggcgagtccgttaccgaagcgaccatcggc
aagtggttcaagaagcccggcgataccgtcaaggccgatgagccgctggtggaactggag
accgacaaggtcaccgtcgaggttcccgcgccggctgccggcgtgctggccgagatcgtc
gccaaggacggcgacaccgtgggcgtcggcgccctgctcggctccatcggcgccggctcc
ggcgctgctgccgcggctcccgctgccgcggctcccgcgcccgccgctgccgcccctgcg
ccggccccggctcccgccgcggcgcctgccgcgtccggctcaagtgtcaatggcccggcc
gtgggccgcatcgccgccgagagcggtgttgatccctcgggcgttgccggttccggcaag
gatggccgcgtcaccaagggtgacatgctggccgccgtcgccgccggcgctgctgccgct
cccgctgcggccccgatcgcggtccgtgccccctcggcacccatcgatgcggtgcgcgag
gagcgggtcaagatgaccaagctgcgccagaccatcgcgcggcgcctgaaggacgcccag
aacaccgcggccatgctcaccacgttcaacgacgtggacatgagcgcggtgatgagcctg
cgcgcccagttcaaggatgcgttcgagaagaagcacggcaccaagctcggcttcatgggc
ttcttcaccaaggcggtcatcgccgccctgaaggacctgccggcggtgaacgccgagatc
gacggccaggacctcgtctacaagaactactacaacatcggtatcgcggtgggcaccgag
aagggcctggtggttccggtggtgcgcgacgccgaccagctctccgtggcggagatcgag
aaggccatcgccggcttcggccgcaaggcgcgtgacggcaagctcggcatcgaggacatg
cagggcggcaccttcaccatcaccaacggcggcatctacggctcgctgatgtccaccccg
atcctgaacgcgccgcagtcgggcatcctcggcatgcaccgcatcgaggagcgcccggtg
gccatcaagggccaggtggtgatccgcccgatgatgtacctcgccctctcctacgaccac
cgcatcgtcgatggccgcgaggccgtgaccttcctggtgcgggtgaaggagaccctggaa
gatcccgcgcggctcgtgctggatctgtga

DBGET integrated database retrieval system