KEGG   Xanthobacter autotrophicus: Xaut_0173Help
Entry
Xaut_0173         CDS       T00581                                 

Definition
mannitol dehydrogenase domain-containing protein
Orthology
K00041  
tagaturonate reductase [EC:1.1.1.58]
Organism
xau  Xanthobacter autotrophicus
Pathway
Pentose and glucuronate interconversions
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xau00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Xaut_0173
Enzymes [BR:xau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.58  tagaturonate reductase
     Xaut_0173
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
170122..171273
Genome map
AA seq 383 aa AA seqDB search
MSGRIIQFGTSRFLQAHVDLFVHEARQAGQAVGPICIVQASGAADRAGRVAAFGRPGGYP
VIIRGIEKGERIERRIDVTSVDRGLSAAQDWQALSDLFAKDADIIVSNTADAGYEIAAAD
RGPALLAGGVPVSFPGKLTALLHRRWRQSGRGLTVLPCELINRNGRVLSAAVAALAPEAG
APEAFLAWLEAEVIFADTLVDRIVSQALEPIGAVAEPYALWVIERRPGLDLPFTHPSVVL
ADDLEPFERLKLHILNLGHTVLADIWRSERRDPGETVREILADADVRGRLDDVYRHEVLP
GFAAHGMGEEAQRYVATTLERFLNPFLDHRIADIAQNHATKVDRRITAFLSWWAEAGAVG
ATPTLDVVIARRQFQPQTERSEA
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
gtgagcggacgcatcatccagttcggcaccagccggtttctccaggcccatgtggacctg
ttcgtccatgaggcgcgacaggccggtcaggcggtcggccccatctgcatcgtgcaggct
tccggcgcggcggaccgggccggccgcgtcgccgccttcggtcggcccggcggctatccg
gtgatcatccgcggcatcgagaagggcgagcgcatcgagcgccgcatcgatgtcaccagc
gtcgaccgcggcctttccgccgcgcaggactggcaggccctgtccgacctgttcgcgaaa
gatgcggacatcatcgtctccaacaccgccgatgcgggctacgagatcgccgccgccgat
cgcggcccggcgctgctggccggcggtgtgcccgtgtcgtttcccggcaagctcacggcg
ctgctccatcgccgctggcgccagtccgggcgcgggctcaccgtgctgccgtgcgaactc
atcaaccgcaacggccgggtgctcagtgccgccgtcgccgccctcgcccccgaggcgggg
gcgccggaggctttcctcgcgtggcttgaggccgaggtgatcttcgccgacacgctggtg
gaccgcatcgtctcgcaggcgctcgagcccatcggcgccgtggccgagccctacgccctt
tgggtgatcgagcgccggccgggacttgatctgcccttcacccatccgagcgtggtgctg
gcggacgacctggagccgttcgagcggctgaagctgcatatcctcaacctgggccacacg
gtgcttgccgacatctggcgctccgagcggcgggatccgggcgagacggtgcgggagatc
ctcgccgatgccgacgtgcgcggccgtctcgacgacgtgtaccgccatgaagtgctgccg
ggatttgccgcccacggcatgggcgaggaggcgcagcgctatgtggccaccacgctggag
cgcttcctcaacccgttcctcgaccaccgcatcgccgacatcgcccagaaccacgccacc
aaggtggaccggcgcatcaccgccttcctgtcctggtgggcggaggctggggccgtgggt
gccaccccgaccctcgacgtggtgatcgcacggcggcagttccagcctcagaccgagcgg
agcgaggcatga

DBGET integrated database retrieval system