KEGG   Xanthobacter autotrophicus: Xaut_0389Help
Entry
Xaut_0389         CDS       T00581                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
xau  Xanthobacter autotrophicus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xau00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Xaut_0389
   00052 Galactose metabolism
    Xaut_0389
   00500 Starch and sucrose metabolism
    Xaut_0389
   00520 Amino sugar and nucleotide sugar metabolism
    Xaut_0389
Enzymes [BR:xau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Xaut_0389
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
415251..416150
Genome map
AA seq 299 aa AA seqDB search
MRQPIRKAILPVAGLGTRFLPATKAVPKEMLTVVDRPVVQHVVDEARAAGIEHIVFVTGR
NKAVIEDHFDRQFELERTLEERGKTKELAQLDRDTPKPGTTSFTRQQLPLGLGHAVWCAR
EIIGDEPFALLLPDMLHMPKAGNGNGQGCLASMVEAYNETGGNLVAVYEVPDDQTHQYGI
VGVGEEKAKGAKAITQMVEKPKAGTAPSNLAISGRYILQPAIFDLLAKQERGAGNEIQLT
DSMLKLKETDPFFAVRFDGSIYDCGSKIGFLMANVAYALSRPDIEGEFRAELNAMLAGN
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcaacccattcgtaaggcgatccttcctgtcgcgggtctcggcacccgcttccta
ccggccaccaaggcggtgccgaaggaaatgctcaccgtcgtggaccgcccggtggtccag
cacgtggtggacgaggcgcgtgccgccggcatcgagcacatcgtgttcgtcaccggccgc
aacaaggcggtgatcgaggatcatttcgaccggcagttcgagctggagcgcaccctcgag
gagcgcggcaagaccaaggaactggcgcagctcgaccgcgacacgccgaagcccggcacc
acctccttcacccgccagcagctgccgctgggcctcggccatgcggtgtggtgcgcgcgc
gagatcatcggcgatgagcccttcgcgctgctgctgcccgacatgctgcacatgcccaag
gcaggtaatggcaacggccagggctgccttgcctccatggtggaagcctataacgagacc
ggcggcaacctggtcgcggtctacgaggttccggacgaccagacccaccagtacggcatc
gtcggcgtgggcgaggagaaggccaagggcgccaaggccatcacccagatggtggagaag
cccaaggccggcaccgcgccgagcaaccttgccatttccggccgctatatcctccagccg
gccattttcgacctgcttgccaagcaggagcgcggcgccggcaacgagatccagctcacc
gattccatgctgaagctgaaggagaccgacccgttcttcgcggtgcgcttcgacggcagc
atctatgattgcggctcgaagatcggcttccttatggccaacgttgcctatgccctgtcc
cgcccggacatcgagggcgagttccgcgccgagctgaacgcgatgcttgcgggcaactga

DBGET integrated database retrieval system