KEGG   Xanthobacter autotrophicus: Xaut_0937Help
Entry
Xaut_0937         CDS       T00581                                 

Definition
(GenBank) Acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
xau  Xanthobacter autotrophicus
Pathway
xau00360  Phenylalanine metabolism
xau00362  Benzoate degradation
xau00620  Pyruvate metabolism
xau00621  Dioxin degradation
xau00622  Xylene degradation
xau00650  Butanoate metabolism
xau01100  Metabolic pathways
xau01120  Microbial metabolism in diverse environments
xau01220  Degradation of aromatic compounds
Module
xau_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:xau00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Xaut_0937
   00650 Butanoate metabolism
    Xaut_0937
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Xaut_0937
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Xaut_0937
   00622 Xylene degradation
    Xaut_0937
   00621 Dioxin degradation
    Xaut_0937
Enzymes [BR:xau01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Xaut_0937
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA DapB_N
Motif
Other DBs
NCBI-ProteinID: ABS66188
JGI: Xaut0937
UniProt: A7IDU5
Position
1056687..1057634
Genome map
AA seq 315 aa AA seqDB search
MSTPRIKAAIIGSGNIGTDLMIKIMRTSRHLEMGAMVGIDPKSDGLARAARLNVPVTHEG
IEGLRRLPNYAEIGVVFDATSAKAHLTNNALLQKDGKKVIDLTPAAVGPFTIPAINGDAN
LEEPNVNMVTCGGQATIPMVYAVKRAVKRLVYGEIVASISSKSAGPGTRANIDEFTETTS
KAIEVLGGAERGKAVIILNPAEPPLIMRDTVFTLSQGGDREAIEASILEMAETVKTYVPG
YRLKQKVQFEVIGDNAPVRIPGIGTASGLKTTILLEVEGAAHYLPAYAGNLDIMTSAALV
TADRWAARRLAKEAA
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgcccaggatcaaagccgccatcatcggctcgggcaacatcggcaccgacctg
atgatcaagatcatgcgcacgtcgcggcacctggagatgggggccatggtgggcatcgat
cccaagtcggacggcctcgcccgcgccgcgcgcctcaacgtgccggtgacccacgagggc
atcgaggggctgcgccgcctgcccaattacgccgagatcggcgtggtgttcgacgccacc
tccgccaaggcccacctcaccaacaatgcgctgctccagaaggacggcaagaaggtgatc
gacctgacccccgcggcggtcggccccttcaccatcccggccatcaatggcgatgccaat
ctcgaagagcccaacgtgaacatggtcacgtgcggcggccaggccaccatcccgatggtc
tatgccgtgaagcgggcggtgaagcgcctggtctacggggagatcgtcgcctccatctcc
tcgaagtccgccggcccggggacgcgcgcgaacatcgacgaattcaccgagaccacctcg
aaggccatcgaggtgctgggcggggccgagcgcggcaaggcggtgatcatcctcaatccc
gccgagccgcccctgatcatgcgcgacacggtcttcaccctcagccagggcggcgatcgg
gaggccatcgaggcctccatccttgagatggccgagacggtgaagacatacgttcccggc
tatcggctgaagcagaaggtgcagttcgaggtcatcggcgacaacgcgccggtgcgcatc
cccggcatcggcactgcttcgggcctcaagaccaccatcctgctcgaggtggagggcgcc
gcccactatctgccggcctatgccggcaacctcgacatcatgacctctgccgcgctggtg
accgctgatcgctgggccgcgcgcaggcttgcgaaggaggccgcgtga

DBGET integrated database retrieval system