KEGG   Xanthobacter autotrophicus: Xaut_1420Help
Entry
Xaut_1420         CDS       T00581                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
xau  Xanthobacter autotrophicus
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xau00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Xaut_1420
   00670 One carbon pool by folate
    Xaut_1420
Enzymes [BR:xau01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Xaut_1420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1623989..1624525
Genome map
AA seq 178 aa AA seqDB search
MTPGQPLRHPLALVVAVSQNGVIGTDGGLPWRLPSDLKRFRALTWGKPLLMGRRTYESIG
RPLPGRTSVVVSTDPAFTVPEGVLKGASLEDGLRLADEAADAMGADEIMVIGGARLFHDT
LPLARTLHLTQVHAAPDGDVFFPAFDEAQWREIARDGPIQGEKDEAAFTALTLVRAGG
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgacccccggccagccgctccgccatcctctggccctcgtggtcgcggtgtcgcagaac
ggggtgatcggcaccgacggcggtctgccgtggcgcctgccctcggacctcaagcgattt
cgcgcgctcacctggggcaagccgctcctcatgggccggcgcacctacgagtccatcggc
cgtccgctgccggggcgcacgtccgtggtggtcagcaccgatcccgccttcacggtgccg
gaaggagtgctgaagggggcaagcctggaggacggactgcgcctcgccgatgaggcggcg
gacgccatgggcgcggatgagatcatggtcatcggcggcgcccgcctgttccatgacacg
ctgccactcgcccgcacgctgcatctcacgcaggtccatgcggcacctgatggcgatgtc
ttcttccctgcgttcgatgaggcccaatggcgcgagatcgcgcgggacggcccgatccag
ggcgagaaggacgaagccgccttcaccgctctgacgctggtgcgcgccggcggctga

DBGET integrated database retrieval system