KEGG   Xanthobacter autotrophicus: Xaut_1479Help
Entry
Xaut_1479         CDS       T00581                                 

Definition
(GenBank) acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
xau  Xanthobacter autotrophicus
Pathway
xau00010  Glycolysis / Gluconeogenesis
xau00620  Pyruvate metabolism
xau00640  Propanoate metabolism
xau00680  Methane metabolism
xau01100  Metabolic pathways
xau01110  Biosynthesis of secondary metabolites
xau01120  Microbial metabolism in diverse environments
xau01130  Biosynthesis of antibiotics
xau01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:xau00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Xaut_1479
   00620 Pyruvate metabolism
    Xaut_1479
   00640 Propanoate metabolism
    Xaut_1479
  Energy metabolism
   00680 Methane metabolism
    Xaut_1479
Enzymes [BR:xau01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Xaut_1479
Lipid biosynthesis proteins [BR:xau01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Xaut_1479
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABS66727
JGI: Xaut1479
UniProt: A7IFD4
Position
complement(1687976..1689931)
Genome map
AA seq 651 aa AA seqDB search
MSDKIYYVPSEWAQKAYVDDAHYQSMYAASVNDPHAFWGEHGKRIDWFTPYTKVKNTSFD
PGHVSIKWFEDGITNVAYNCVDRHLETRGDQVAIIWEGDSPDESRNITYRELSSEVNKLA
NVLRNRGVEKGDRVTIYLPMIPEAAFAMLACARLGAIHSIVFGGFSPDSLAGRVADCGSK
CIITADEGLRGGRKVPLKANVDAAIAQINGGVDHVIVVRRTGGKVDMLPGRDVYYDEATA
MVTDECPAEHVNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYASMTHQYIFDYHPGDIYW
CTADVGWVTGHSYIVYGPLANGATTLMFEGIPNYPSVSRFWDVIDKHKVNIFYTAPTAIR
SLMQAGEEPVKRTSRSSLRLLGSVGEPINPEAWEWYYRVVGEERCPIVDTWWQTETGGIL
ITPLPGATKLKPGSATRPFFGVMPEVVDAEGKVLEGACEGNLVIADSWPGQMRTVYGDHE
RFEQTYFSTYPGKYFTGDGCRRDADGFYWITGRVDDVINVSGHRMGTAEVESALVAHPKV
SEAAVVGFPHDIKGQGIYAYVTLMDGEEPTEELRKELVGWVRREIGPIASPDLIQFAPGL
PKTRSGKIMRRILRKIAEDQFESLGDTSTLADPGVVEDLIHNRQNKRDAAA
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacaagatctactacgttccctccgaatgggcccaaaaggcctatgtggacgat
gcgcattatcagtccatgtacgccgcctcggtgaacgacccccatgcattctggggcgag
cacggcaagcgcatcgactggttcacgccctataccaaggtgaagaacacctcgtttgat
cccggccacgtctccatcaagtggttcgaggacggcatcaccaacgtcgcctacaattgc
gtggaccgtcaccttgagacccgcggcgaccaggtggccatcatctgggaaggcgacagc
ccggacgagagccgcaacatcacctatcgcgaactctccagcgaggtgaacaagctcgcc
aacgtgctgcgcaaccgcggcgtggagaagggcgaccgcgtcaccatctatctgccgatg
atccccgaggcggccttcgcgatgctcgcctgcgcgcggctcggcgcgatccattccatc
gtcttcggcggtttctcgccggacagcctggccggccgcgtggccgactgcggctccaag
tgcatcatcaccgccgacgaaggcctgcgcggcggccgcaaggtgccgctgaaggccaac
gtggacgcggccatcgcccagatcaacggcggcgtggaccatgtgatcgtggtgcgccgc
accggcggcaaggtggatatgctgccgggccgcgacgtctattacgacgaagccaccgcc
atggtcaccgacgagtgtccggccgagcatgtgaacgcggaagatccgctgttcatcctc
tacacctccggctccaccggcaagccgaagggcgtgctgcacaccaccggcggctatctc
gtctatgcgtccatgacgcatcagtacatcttcgactaccaccccggcgacatctactgg
tgcaccgccgacgtgggctgggtgacgggccactcctacatcgtctatggcccgctcgcg
aacggcgccaccacgctgatgttcgagggcatccccaactatcccagcgtgtcgcgcttc
tgggatgtgatcgacaagcacaaggtcaacatcttctacaccgcccccaccgccatccgc
tcgctgatgcaggcgggcgaggagccggtgaagcgcacctcgcgctcgtcgctgcgcctg
ctcggctcggtgggcgagcccatcaatccggaagcctgggagtggtactaccgcgtcgtc
ggcgaggagcgctgccccatcgtcgacacctggtggcagaccgagaccggcggcatcctc
atcacccccctgcccggcgccaccaagctgaagcccggctccgccacccgccccttcttc
ggcgtgatgcccgaggtggtggacgcggaaggcaaggtgcttgagggcgcctgcgagggc
aacctcgtgatcgccgacagctggccgggccagatgcgcacggtctatggcgaccatgag
cgcttcgagcagacctacttctccacctatcccggcaagtacttcaccggcgacggctgc
cgccgcgacgcggacggcttctactggatcaccggccgcgtggacgacgtgatcaacgtg
tccggccaccgcatgggcacggcggaggtggaaagcgccctcgtcgcccatcccaaggtg
tcggaagccgccgtggtgggcttccctcacgacatcaagggccagggcatctacgcctat
gtcaccctgatggacggcgaggagcccaccgaggaactgcgcaaggaactggtgggctgg
gtgcgccgcgagatcggccccatcgcctccccggacctgatccagttcgcgccgggcctg
cccaagacccgctcgggcaagatcatgcgccgcatcctgcgcaagatcgccgaggaccag
ttcgagagcctgggcgacacctcgaccctcgccgatcccggcgtggtggaggacctcatc
cacaaccgccagaacaagcgcgacgcagccgcctga

DBGET integrated database retrieval system