KEGG   Xanthobacter autotrophicus: Xaut_1550Help
Entry
Xaut_1550         CDS       T00581                                 

Definition
cyclic nucleotide-binding protein
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
xau  Xanthobacter autotrophicus
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xau00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Xaut_1550
   00330 Arginine and proline metabolism
    Xaut_1550
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Xaut_1550
Enzymes [BR:xau01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Xaut_1550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1761186..1763027)
Genome map
AA seq 613 aa AA seqDB search
MPNFLPLATTPLETPLLRAIRDIHTRFTPLHDGEVASYIPELGKADPDHFGIAVATTDGH
VYEAGDTAVPFTIQSVSKAIVYALALDMLGSEKVEAAIGVEPSGEAFNSIRLKADNRPFN
AMVNAGAICCSGLLAEAAGDEAFELIRTTLSRFAGRELEVDDAVFQSERQTGDRNRAIAY
LLRTYGGVRGDVDHILDTYFRQCSVLVTARDLAVMGASFANHGVNPVTGEMVASNYAVAR
TLAVMISSGMYDFAGEWIYRVGVPAKSGVGGGILAALPSQLGLGIFSPRLDAHGNSVRGL
RTCSALSDAFDLHMLSRRDDVRTCIAADYDFRTVPSKPGRQPHEQSILEQRSGSIRVLEL
AGKLSFATMDYVTRRLTDPAGVPAFLILNLHRVSTITDAGLRLFTGLIRNQLPASTTTVI
AGVEGNSPVAPQVKAMKEEGVRVRIFPTYDAAVDWAEDQIVYRHGGFSQIGIEADLSGQA
LLAGLSPQELADLSRLGTRVVFDAGTRIIDANEPPARVYFLVRGMVSVRSMHDVRLSTLI
PGMAFGELALIDQPRSADVWADTEAVCLEISAEQFRAFQETHARAADRIMRNLAILLAGR
VRMATARIDMLTG
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
gtgccgaatttcctgccccttgccacgacgcccctcgaaacaccgctgctgcgcgccatc
cgggatatccacacccgcttcacgcccctgcatgacggcgaggtcgcctcctacatcccg
gaactgggcaaggccgacccggaccatttcgggatcgccgtggccaccaccgacggccat
gtctatgaagcgggcgacacggccgtgccgttcaccatccagtcggtgtccaaggccatc
gtctacgccctcgccctcgacatgctggggtccgagaaggtggaggcagccatcggcgtg
gagccgagcggcgaggccttcaattccatccgcctgaaggccgacaaccgccccttcaac
gccatggtgaatgccggcgccatctgctgcagcgggcttctcgccgaggctgccggcgac
gaggccttcgagctgatccgcaccacgctcagccgctttgccgggcgcgagctggaggtg
gacgatgcggtgttccagtcggagcgccagaccggcgaccgcaaccgcgccatcgcctac
ctgctgcgcacctatggcggcgtgcggggcgacgtggatcacatcctcgacacctatttc
cgccagtgctcggttctggtcaccgcccgcgacctggcggtgatgggggcgagcttcgcc
aatcacggggtcaatccggtgaccggggagatggtggcctcaaactacgccgtggcgcgc
accctggcggtgatgatctcctccggcatgtatgactttgccggcgagtggatctatcgg
gtgggcgtgccggccaagagcggcgtcggtggcggcattctcgccgctttgccctcccag
ctgggcctcggcatcttctcgccccggctcgatgcccatggcaacagcgtgcgcggcctg
cgcacctgctccgccctctccgacgccttcgacctgcacatgctgtcgcggcgcgacgac
gtgcgcacctgcatcgccgccgactacgatttccgcaccgtgccctccaagcccgggcgc
cagccccacgagcagagcatcctggaacagcgctccggctccatccgcgtgctggaactg
gccggcaagctctccttcgccaccatggattatgtgacccgccggctcaccgatcccgca
ggcgtgccggccttcctgatcctcaacctgcaccgggtctccaccatcaccgatgcgggg
ctgcgcctgttcaccggcctgatccgcaatcagcttccggcctccaccaccacggtgatc
gccggagttgaaggcaactcgccggtggcgccgcaggtcaaggccatgaaggaggaaggc
gtgcgcgtgcgcatcttccccacctacgacgccgccgtggactgggccgaggaccagatc
gtctaccgccatggcggcttctcgcagatcggcatcgaagccgacctgtcaggccaggcg
ctgctcgccgggctgtcgccgcaggaactggccgacctctcccgcctcggcacccgcgtg
gtgttcgatgccggcacgcggatcatcgacgccaatgaaccgccggcccgggtctatttc
ctggtgcgcggcatggtcagcgtgcgctcaatgcacgacgtgcgcctgtcgacgttgatc
ccgggcatggccttcggcgagctggcgctcatcgatcagccgcgcagtgccgacgtgtgg
gccgacacggaggcggtctgcctggagatttccgccgagcagttccgcgccttccaggag
acccatgcccgcgccgccgaccggatcatgcgcaacctcgccatcctgctggccggccgg
gtgcgcatggccacggcgcggatcgacatgctgacggggtga

DBGET integrated database retrieval system