KEGG   Xanthobacter autotrophicus: Xaut_1572Help
Entry
Xaut_1572         CDS       T00581                                 

Definition
(GenBank) biotin/lipoyl attachment domain-containing protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
xau  Xanthobacter autotrophicus
Pathway
xau00010  Glycolysis / Gluconeogenesis
xau00020  Citrate cycle (TCA cycle)
xau00620  Pyruvate metabolism
xau01100  Metabolic pathways
xau01110  Biosynthesis of secondary metabolites
xau01120  Microbial metabolism in diverse environments
xau01130  Biosynthesis of antibiotics
xau01200  Carbon metabolism
Module
xau_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:xau00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Xaut_1572
   00020 Citrate cycle (TCA cycle)
    Xaut_1572
   00620 Pyruvate metabolism
    Xaut_1572
Enzymes [BR:xau01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Xaut_1572
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_6 Biotin_lipoyl Abhydrolase_1 E3_binding Hydrolase_4 Biotin_lipoyl_2 Ser_hydrolase
Motif
Other DBs
NCBI-ProteinID: ABS66819
JGI: Xaut1572
UniProt: A7IFM6
Position
1783406..1784791
Genome map
AA seq 461 aa AA seqDB search
MPKEILMPALSAGMEEGHLVRWLKKEGEAVKRGDLLAEIETDKAVMEMEAEDEGRLGPIL
IGDGSRGVAVGTLIASILAEGEAAPARVASVAAAPAVAAPAAVAVPSPAPSTPAPFARAP
AATVAPAPSLAARAPSIAALVAARKVVASPLARRLADDFGVDLSTLTGSGPRGRIVRIDV
EKARHQPVAPAAPRFSPAAPRLGSGSGQGGLNHAWLRQGEGRPLVLVHGFGSELNGWRPF
LAGAAVSRPVLGIDLPGHGGSAGHGAARFEALVAAVGETLQGLGLFDLDLVAHSLGAAVA
VALAAEGYPDVRSLFLLAPAGLGPDINGAFVSGLARARTAESLAPWLGELVADPSVLTPA
FVRASAAARADDALVAAQQRLAAALFPDGTQAFSVRAELEQLRIPVTVVAGTEDKIIPPG
HVRRLPGMVGLHLFPGVGHMPQLEIRDEVWRLLERHLRAAG
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaggaaatcctgatgcccgccctctctgccggaatggaggagggtcacctcgtc
cgctggctgaagaaggaaggcgaggcggtgaagcgtggtgacctgctcgccgagatcgag
accgacaaggccgtcatggagatggaggcggaggacgaaggccgcctcggccccatcctg
atcggcgacggttcgcgcggcgtggcggtgggcacactcatcgcctccatcctcgcggaa
ggggaagccgcgcccgcgcgggtcgcgtccgtcgccgccgcgccggccgtggcggcgcct
gcggcggttgctgttccttcgcctgcgccatcgacacctgcgcccttcgcacgggcgccc
gctgcgacggttgcaccggccccgagcctcgcggcgcgggcgccgtccatcgcggccctt
gtcgccgcgcgcaaggtcgttgcctcgcccctcgcgaggcgcctcgcggacgatttcggc
gtcgatctcagcacgctcaccggctcaggtcccaggggccgcatcgtgcggatcgacgtg
gagaaggcgcgccaccagccggttgcgcccgccgcgccgcgtttttcccctgctgcgccg
cgtcttggcagcgggtcggggcaggggggactcaaccatgcgtggctgcggcagggtgaa
ggccggccgctggtgctggtccacggcttcggctcggagctgaacggctggcgtcccttc
cttgccggcgctgcggtgtcgcggccggtgctcggcatcgacctgccaggccatggcgga
tcggccggccacggcgccgcccgcttcgaggcgctagtggcggcggtgggcgagaccctg
cagggcctcggcctgttcgatctggatcttgtcgcccattccctcggcgcggcggtggcg
gtggcgctcgcggccgaaggctatcccgatgtgcgctccttgttcctgctcgcgccggcg
ggccttgggcccgatatcaacggcgccttcgtatccggccttgcccgcgcccgcaccgcc
gagagccttgcgccctggctgggtgaactagtggccgatccttcggtgctgacccccgcc
ttcgtgcgggccagcgccgcggcccgtgccgacgacgcgctggtagccgcccagcagcgt
ctcgccgcagccctgttcccggacggcacgcaggccttcagcgtgcgcgcggagctggag
cagttgcgcattccggtcactgtcgtggccggcaccgaggataagatcatcccgccgggc
catgtgcggcggctgcctggtatggtgggcctgcacctgtttccgggagttggccacatg
ccgcagctggagatccgcgacgaggtctggcgccttctggagcgccatttgcgcgcggcg
ggatga

DBGET integrated database retrieval system