KEGG   Xanthobacter autotrophicus: Xaut_1572Help
Entry
Xaut_1572         CDS       T00581                                 

Definition
biotin/lipoyl attachment domain-containing protein
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
xau  Xanthobacter autotrophicus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:xau00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Xaut_1572
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Xaut_1572
   00020 Citrate cycle (TCA cycle)
    Xaut_1572
   00620 Pyruvate metabolism
    Xaut_1572
Enzymes [BR:xau01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Xaut_1572
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1783406..1784791
Genome map
AA seq 461 aa AA seqDB search
MPKEILMPALSAGMEEGHLVRWLKKEGEAVKRGDLLAEIETDKAVMEMEAEDEGRLGPIL
IGDGSRGVAVGTLIASILAEGEAAPARVASVAAAPAVAAPAAVAVPSPAPSTPAPFARAP
AATVAPAPSLAARAPSIAALVAARKVVASPLARRLADDFGVDLSTLTGSGPRGRIVRIDV
EKARHQPVAPAAPRFSPAAPRLGSGSGQGGLNHAWLRQGEGRPLVLVHGFGSELNGWRPF
LAGAAVSRPVLGIDLPGHGGSAGHGAARFEALVAAVGETLQGLGLFDLDLVAHSLGAAVA
VALAAEGYPDVRSLFLLAPAGLGPDINGAFVSGLARARTAESLAPWLGELVADPSVLTPA
FVRASAAARADDALVAAQQRLAAALFPDGTQAFSVRAELEQLRIPVTVVAGTEDKIIPPG
HVRRLPGMVGLHLFPGVGHMPQLEIRDEVWRLLERHLRAAG
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaggaaatcctgatgcccgccctctctgccggaatggaggagggtcacctcgtc
cgctggctgaagaaggaaggcgaggcggtgaagcgtggtgacctgctcgccgagatcgag
accgacaaggccgtcatggagatggaggcggaggacgaaggccgcctcggccccatcctg
atcggcgacggttcgcgcggcgtggcggtgggcacactcatcgcctccatcctcgcggaa
ggggaagccgcgcccgcgcgggtcgcgtccgtcgccgccgcgccggccgtggcggcgcct
gcggcggttgctgttccttcgcctgcgccatcgacacctgcgcccttcgcacgggcgccc
gctgcgacggttgcaccggccccgagcctcgcggcgcgggcgccgtccatcgcggccctt
gtcgccgcgcgcaaggtcgttgcctcgcccctcgcgaggcgcctcgcggacgatttcggc
gtcgatctcagcacgctcaccggctcaggtcccaggggccgcatcgtgcggatcgacgtg
gagaaggcgcgccaccagccggttgcgcccgccgcgccgcgtttttcccctgctgcgccg
cgtcttggcagcgggtcggggcaggggggactcaaccatgcgtggctgcggcagggtgaa
ggccggccgctggtgctggtccacggcttcggctcggagctgaacggctggcgtcccttc
cttgccggcgctgcggtgtcgcggccggtgctcggcatcgacctgccaggccatggcgga
tcggccggccacggcgccgcccgcttcgaggcgctagtggcggcggtgggcgagaccctg
cagggcctcggcctgttcgatctggatcttgtcgcccattccctcggcgcggcggtggcg
gtggcgctcgcggccgaaggctatcccgatgtgcgctccttgttcctgctcgcgccggcg
ggccttgggcccgatatcaacggcgccttcgtatccggccttgcccgcgcccgcaccgcc
gagagccttgcgccctggctgggtgaactagtggccgatccttcggtgctgacccccgcc
ttcgtgcgggccagcgccgcggcccgtgccgacgacgcgctggtagccgcccagcagcgt
ctcgccgcagccctgttcccggacggcacgcaggccttcagcgtgcgcgcggagctggag
cagttgcgcattccggtcactgtcgtggccggcaccgaggataagatcatcccgccgggc
catgtgcggcggctgcctggtatggtgggcctgcacctgtttccgggagttggccacatg
ccgcagctggagatccgcgacgaggtctggcgccttctggagcgccatttgcgcgcggcg
ggatga

DBGET integrated database retrieval system