KEGG   Xanthobacter autotrophicus: Xaut_1693Help
Entry
Xaut_1693         CDS       T00581                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
xau  Xanthobacter autotrophicus
Pathway
xau00260  Glycine, serine and threonine metabolism
xau00400  Phenylalanine, tyrosine and tryptophan biosynthesis
xau01100  Metabolic pathways
xau01110  Biosynthesis of secondary metabolites
xau01130  Biosynthesis of antibiotics
xau01230  Biosynthesis of amino acids
Module
xau_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:xau00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Xaut_1693
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Xaut_1693
Enzymes [BR:xau01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Xaut_1693
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABS66938
JGI: Xaut1693
UniProt: A7IFZ5
Position
1905593..1906810
Genome map
AA seq 405 aa AA seqDB search
MTALNSYRTGPDFRGHFGIHGGRFVAETLMPLILELEQAYEAAKADPAYHAEMAGYLTHY
VGRPSPLYFAERLTEHLGGAKVYLKREELNHTGSHKVNNVLGQILLARRMGKERIIAETG
AGQHGVATATMCARFGLKCVVYMGAVDVERQAPNVFRMKMLGAEVVAVQSGSRTLKDAMN
EALRDWVTNVHDTFYCIGTVAGPHPYPAMVRDFQSIIGRETREQMQEMEGRLPDSLIACV
GGGSNAMGLFHPFLDDPTVAIYGVEAAGRGLDTHEHAASIAGGRPGVLHGNRTYLLMDGD
GQITEAHSISAGLDYPGIGPEHSWLNDVGRVTYLSCTDQEALDAFQLLTRLEGIIPALES
AHAIAKVVELAPKLPKDHLMVVNLSGRGDKDVPQVAEILGTSLGA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgctctcaattcctatcgcaccggccccgatttccggggtcacttcggcatccat
ggcgggcgcttcgtcgccgagaccctgatgccgctgatcctggagctggagcaggcctac
gaggcggcgaaggcggacccggcctatcacgccgagatggcgggctatctcacccattat
gtgggccgcccctccccgctctatttcgccgagcgcctcaccgagcatctgggcggcgcc
aaggtctatctgaagcgcgaggagctgaaccacaccggctcccacaaggtgaacaacgtg
ctcggccagatcctgctcgcccgccgcatgggcaaggagcggatcatcgccgagaccggc
gccggccagcatggcgtcgccaccgccaccatgtgcgcccgcttcggcctgaagtgcgtg
gtctacatgggcgccgtggacgtggagcggcaggcccccaacgtgttccgcatgaagatg
ctgggcgccgaggtggtcgccgtgcagtccggctcgcgcaccctgaaggacgccatgaac
gaggcgctgcgcgactgggtcaccaacgtgcacgacaccttctactgcatcggcacggtg
gccggtccccacccctatccggccatggtgcgcgacttccagtccatcatcggccgcgag
acgcgcgagcagatgcaggagatggaaggccgcctgcccgacagcctgatcgcctgcgtg
ggtggtggctccaatgccatgggcctgttccatcccttcctcgacgatcccaccgtggcg
atctacggggtggaggcggcgggtcgcggcctcgacacccacgagcatgccgcctccatc
gccggcgggcggccgggggtgctgcacggcaaccgcacctacctgctcatggacggcgac
ggccagatcaccgaggcccattccatctcggccggcctcgattatcccggcatcgggccg
gagcattcctggctcaacgacgtgggccgtgtgacctacctctcctgcaccgaccaggag
gcgctggacgccttccagctgctcacccggctcgagggcatcatcccggcactggaatcc
gcacatgccatcgccaaggtggtggagctggcacccaagctgccgaaggatcacctgatg
gtggtcaacctgtccggccgcggggacaaggacgtgccccaggtggcggaaattctcggc
accagcctgggggcttag

DBGET integrated database retrieval system