KEGG   Xanthobacter autotrophicus: Xaut_1695Help
Entry
Xaut_1695         CDS       T00581                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
xau  Xanthobacter autotrophicus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:xau00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Xaut_1695 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Xaut_1695 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Xaut_1695 (trpA)
Enzymes [BR:xau01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Xaut_1695 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1907274..1908119
Genome map
AA seq 281 aa AA seqDB search
MHPGRPMTTRISTRFAALKEEGRPGLVTFVTAGDPDGETSLAILKALPGAGADVIELGIP
FTDPMADGPAIQAAGLRALKGGQTLAKTIEMVRVFRTEDTTTPVVLMGYFNPIYIYGVDR
FLTDAKVAGVDGLIVVDLPPEEDDELCLPALNAGLDFIRLATPTTDDKRLPTVLEHTAGF
VYYVSITGITGSATPDADLVAAAVARIKSHTDLPVAVGFGVRTPEQAKAIAAGADAVVVG
SALVEVVRRTLDAEGNATANTLPGVEALVSELAEAVRSIKR
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
ttgcatccaggcaggcccatgaccacgcgcatctccacccgcttcgccgcgctgaaagag
gaaggccgccccggcctcgtcaccttcgtcacggcgggcgatccggacggggagacctcc
ctcgccatcctcaaggcgctgcccggcgccggcgcggacgtgatcgagctgggcattccc
ttcaccgatcccatggccgacggcccggccatccaggcggcgggcctgcgcgcgctcaag
ggcggccagaccctggccaagaccatcgagatggtccgggtcttccgcaccgaggacacc
accacgccggtggtgctcatgggctatttcaatcccatctacatctatggcgtggaccgc
ttcctcaccgacgccaaggtggcgggggtggacggcctcatcgtggtggacctgccgccg
gaggaggacgacgagctctgcctgccagccctgaacgccgggctcgacttcatccgcctc
gccacccccaccaccgacgacaagcgcctgccgacggtgctcgagcacacggcgggcttc
gtctattacgtctccatcaccggcatcaccggctcggcgacgccggacgcggatctggtg
gccgccgccgtcgcccgcatcaagtcccacaccgacctgccggtggccgtgggcttcggc
gtgcggacgccggaacaggccaaggccatcgccgccggtgccgacgcggtggtggtgggc
tccgccctggtggaggtggtgcgccgcaccctcgatgccgagggcaacgccaccgccaac
accctgccgggcgtggaagcgctggtgagcgaactggccgaggcggtgcgcagcatcaag
cgctga

DBGET integrated database retrieval system